CAZyme Information: KAF7623208.1

Basic Information

• Species: Aspergillus flavus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus flavus
• CAZyme ID: KAF7623208.1
• CAZy Family: GH28
• CAZyme Description: Pectate lyase superfamily protein-domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A7G5JED9]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
830		87858.98	5.2986

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AflavusNRRL3357	14313	332952	0	14313

• Gene Location: location=AAIH03000161:1434561-1437343(-)

Full Sequence      

MVFSSVFRTFALCLLIAQVWAGGIQDLVNALMKPVEDSVSHLPPLDWVPHPKGIPFPTKN
ETAEPWRHLNTAPVAPVAPAAPAAPATSSAHAPLASASSCSSNNGSSGYWYEKIEHNDQS
SFLSSEYKDSYKVFRNVVSDYKADNTGNQDSAPAIQRAIEAGASNGPSRNSKSMGTTGQP
AVVYLPGGTYLLQTSLQLFTGTVLVGDPSNPPVLKAASGYSLDHIVYAKDPNHEGTNNFY
IGIKNIVLDSTGVDSAKSLSLLDWTVSQATQLANVAFHMPTGSKHTGLTTQYDYNSNIIV
NDLSFSGGGVGMKLSGQQWVFKNLTFTGTTIGVVAGATDIVFLGCQFQQGAIGINASETS
GSLTVIDSSASGLDTFITSGDSGGAGNAIVLENVQSSGVTVSLGGKAVLTGGVSDTWVHG
TMYNSGSTNKERVDGKIVVTNRASSLLSGNKYYTVSPPTYQEYRSNKVLNIKSVSSSPVY
GDGQTDDTANINKILSENKDCKVIYFPAGTYIVTDTIFVPSGTRIIGDAFASTISAVGNN
FKDEAFVRVMIRVGYPGDMGVAQISDMVLTVGDILPGCQLMEVNIAGKNQGDVGFWNVHF
RIGGGVGSRVHSDCTSSPDSCKAAYGLLHLTGTSSAYIENMWGWTADHDLDGSSTQTIST
GRGLLVEAVAATWLIGTGFEHHTLYQYNFEHAHNVLATMQQSETPYWQGVGSTLAPAPWG
NHLSASDPDFSWCAGDDATCRMALFERINGASNLFLYGGCNWAFFNNNGGCNGKCQKNAV
QIIESSALYLYGTNTKSTANMILEGSTTIATEDDNAGGWGGVIAAFLYKT

Enzyme Prediction     

No EC number prediction in KAF7623208.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH55	99	826	2.7e-225	0.9918918918918919

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
403800	Pectate_lyase_3	2.80e-57	134	355	1	213	Pectate lyase superfamily protein. This family of proteins possesses a beta helical structure like Pectate lyase. This family is most closely related to glycosyl hydrolase family 28.
403800	Pectate_lyase_3	1.86e-09	481	541	11	74	Pectate lyase superfamily protein. This family of proteins possesses a beta helical structure like Pectate lyase. This family is most closely related to glycosyl hydrolase family 28.
227721	Pgu1	5.01e-04	137	247	84	201	Polygalacturonase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW46035.1|GH55	0.0	1	830	1	830
QMW33981.1|GH55	0.0	1	830	1	830
UDD62843.1|GH55	0.0	1	830	1	830
QRD94287.1|GH55	0.0	32	830	1	787
BAE63373.1|GH55	0.0	19	830	26	765

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3EQN_A	3.25e-98	109	826	26	755	Chain A, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium],3EQN_B Chain B, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium],3EQO_A Chain A, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium],3EQO_B Chain B, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium]
5M5Z_A	9.46e-89	107	826	4	753	Chain A, Beta-1,3-glucanase [Thermochaetoides thermophila],5M60_A Chain A, Beta-1,3-glucanase [Thermochaetoides thermophila]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4B0V1|E13B_ARTBC	2.12e-99	103	826	37	873	Probable glucan endo-1,3-beta-glucosidase ARB_02077 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_02077 PE=1 SV=1
sp|P49426|EXG1_COCCA	1.30e-89	108	792	47	742	Glucan 1,3-beta-glucosidase OS=Cochliobolus carbonum OX=5017 GN=EXG1 PE=1 SV=1
sp|P53626|E13B_TRIHA	2.80e-88	140	826	60	760	Glucan endo-1,3-beta-glucosidase BGN13.1 OS=Trichoderma harzianum OX=5544 GN=bgn13.1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000217	0.999749	CS pos: 21-22. Pr: 0.9809

TMHMM  Annotations     

There is no transmembrane helices in KAF7623208.1.