CAZyme Information: KAF7622830.1

Basic Information

• Species: Aspergillus flavus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus flavus
• CAZyme ID: KAF7622830.1
• CAZy Family: GH24
• CAZyme Description: SGNH_hydro domain-containing protein [Source:UniProtKB/TrEMBL;Acc:B8NUE9]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
333	AAIH03000161|CGC3	36585.86	4.4713

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AflavusNRRL3357	14313	332952	0	14313

• Gene Location: location=AAIH03000161:514096-515097(+)

Full Sequence      

MVLPLRRLSAPRALSSLCFCLAIICLLVMLTMTAMRDTIEEETGNEMTAHGLLEPTLKVM
IVGDSMSQGREGDWTWRFRIWEWFKDQGLPVDFVGPYNGTAQSDLPSLPATPSGKEESHW
KSEIRTSGGYAAGVSEDFDKDHFAIWGRAVAIDKGLIYDVLAAYPTDLILLMLGFNDMAW
FHTDAAGTVDSMQTFILNARATNPRLKFAIANVPQRTFISGREDLPVSTNIYNALLREAI
PGWSTPDSPVQLVELHENYDCAPIACPVGYDGLHPNAKGEYQIARAFTLTLVKDLNIGVS
PLSIPTMPDGPLSVSSNPQDVGSLPQEVPDMIL

Enzyme Prediction     

No EC number prediction in KAF7622830.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE3	57	288	1.1e-49	0.979381443298969

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238871	XynB_like	2.51e-46	139	291	14	157	SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB. Most likely a secreted hydrolase with xylanase activity. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
404371	Lipase_GDSL_2	9.37e-08	147	283	43	176	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
238872	SGNH_hydrolase_like_2	8.00e-05	156	287	53	188	SGNH_hydrolase subfamily. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
238141	SGNH_hydrolase	8.40e-05	142	287	40	184	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
238866	sialate_O-acetylesterase_like2	3.04e-04	167	282	50	158	sialate_O-acetylesterase_like subfamily of the SGNH-hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAE63679.1|CE0	4.27e-237	1	329	1	329
CAK39824.1|CE0	6.40e-120	54	317	136	394
BAE60780.1|CE0	5.00e-92	109	317	19	228
UKZ09962.1|CE0	1.15e-85	57	328	512	785
SCG40251.1|CE0	2.06e-77	57	317	336	597

PDB Hits     

KAF7622830.1 has no PDB hit.

Swiss-Prot Hits     

KAF7622830.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999987	0.000034

TMHMM  Annotations     

Start	End
13	35