CAZyme Information: KAF7621951.1

Basic Information

• Species: Aspergillus flavus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus flavus
• CAZyme ID: KAF7621951.1
• CAZy Family: GH17
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
578		64562.41	6.6158

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AflavusNRRL3357	14313	332952	0	14313

• Gene Location: location=AAIH03000170:369337-371482(+)

Full Sequence      

MVDTEYDALIVGSGPIGATYAKILADAGKVVLMVETGTQESKIAGEHKKNAINYQKDIDA
FVHVIKGSLHYTSVPTNKAAVPTLAPISWKANGQIFNGQNPRQDPNVNLDANGVARNVGG
MSTHWTCATPRQKEKVERSDIFSGDEWDSLYKEAEKLIGTSKTVLNDSIRQELVMEILND
EYGKRSAEPLPLAAKKNGSTAYITWSSSSTILDAMNCKDKFTLWPEHHCEKFVVEETDNG
PQVTKAKIRKLATDELITVKAKVFIACGGPILTPQLLFNSDFVPTKPNRDPRTQIPLEDD
EEGIAPPPDIPEYLKLPALGRYLTEQSMCFCQIVLKKEWIEAVANPKKNPYQSDGVKRKK
WEKLKEGWKERVQKHMKRFNDPIPFPFDDLDPQVTLPLDYHHPWHTQIHRDAFSYGAAPP
AIDKRTIVDLRFFGTVEPDWKNYVTFETDIRDAYGMPQPTFRYKLNDEDRKRSHQMMKDM
EEAAGALGGYLPGSEPQFLAPGLALHVCGTTRAQKKEKECDPDPKETSCCDENSKIWGIH
NLYVGGLNVIPGANGSNPTLTAMCFAIKSAKSILEGNS

Enzyme Prediction     

EC	1.1.3.10:7

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	5	575	4.5e-270	0.9927140255009107

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
274143	pyranose_ox	0.0	6	574	1	543	pyranose oxidase. Pyranose oxidase (also called glucose 2-oxidase) converts D-glucose and molecular oxygen to 2-dehydro-D-glucose and hydrogen peroxide. Peroxide production is believed to be important to the wood rot fungi in which this enzyme is found for lignin degradation.
225186	BetA	2.78e-16	1	575	3	535	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	6.70e-15	451	568	12	142	GMC oxidoreductase. This domain found associated with pfam00732.
240384	PTZ00367	5.91e-04	5	46	33	76	squalene epoxidase; Provisional
223636	Glf	0.001	6	45	2	38	UDP-galactopyranose mutase [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD93534.1|AA3_4	0.0	1	578	1	578
QMW34644.1|AA3_4	0.0	1	578	1	600
UDD63603.1|AA3_4	0.0	5	578	6	601
QMW46713.1|AA3_4	0.0	5	578	6	601
BAE56707.1|AA3_4	0.0	10	578	39	629

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3BG7_A	6.88e-140	2	575	43	611	Chain A, Pyranose oxidase [Trametes ochracea],3BG7_B Chain B, Pyranose oxidase [Trametes ochracea],3BG7_C Chain C, Pyranose oxidase [Trametes ochracea],3BG7_D Chain D, Pyranose oxidase [Trametes ochracea],3BG7_E Chain E, Pyranose oxidase [Trametes ochracea],3BG7_F Chain F, Pyranose oxidase [Trametes ochracea],3BG7_G Chain G, Pyranose oxidase [Trametes ochracea],3BG7_H Chain H, Pyranose oxidase [Trametes ochracea]
2F5V_A	8.27e-140	2	575	15	583	Reaction geometry and thermostability mutant of pyranose 2-oxidase from the white-rot fungus Peniophora sp. [Peniophora sp. SG]
2F6C_A	8.27e-140	2	575	15	583	Chain A, Pyranose 2-oxidase [Peniophora sp. SG]
3BG6_A	9.71e-140	2	575	43	611	Chain A, Pyranose oxidase [Trametes ochracea],3BG6_B Chain B, Pyranose oxidase [Trametes ochracea],3BG6_C Chain C, Pyranose oxidase [Trametes ochracea],3BG6_D Chain D, Pyranose oxidase [Trametes ochracea],3BG6_E Chain E, Pyranose oxidase [Trametes ochracea],3BG6_F Chain F, Pyranose oxidase [Trametes ochracea],3BG6_G Chain G, Pyranose oxidase [Trametes ochracea],3BG6_H Chain H, Pyranose oxidase [Trametes ochracea]
1TT0_A	9.71e-140	2	575	43	611	Crystal Structure of Pyranose 2-Oxidase [Trametes ochracea],1TT0_B Crystal Structure of Pyranose 2-Oxidase [Trametes ochracea],1TT0_C Crystal Structure of Pyranose 2-Oxidase [Trametes ochracea],1TT0_D Crystal Structure of Pyranose 2-Oxidase [Trametes ochracea],2IGK_A Crystal structure of recombinant pyranose 2-oxidase [Trametes ochracea],2IGK_B Crystal structure of recombinant pyranose 2-oxidase [Trametes ochracea],2IGK_C Crystal structure of recombinant pyranose 2-oxidase [Trametes ochracea],2IGK_D Crystal structure of recombinant pyranose 2-oxidase [Trametes ochracea],2IGK_E Crystal structure of recombinant pyranose 2-oxidase [Trametes ochracea],2IGK_F Crystal structure of recombinant pyranose 2-oxidase [Trametes ochracea],2IGK_G Crystal structure of recombinant pyranose 2-oxidase [Trametes ochracea],2IGK_H Crystal structure of recombinant pyranose 2-oxidase [Trametes ochracea]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5B2E9|P2OX_EMENI	2.23e-210	5	573	22	574	Pyranose 2-oxidase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=p2ox PE=3 SV=2
sp|Q75ZP8|P2OX_LYOSH	6.79e-144	7	575	37	601	Pyranose 2-oxidase OS=Lyophyllum shimeji OX=47721 GN=p2ox PE=2 SV=1
sp|Q5G234|P2OX_TRAPU	5.44e-141	2	573	43	609	Pyranose 2-oxidase OS=Trametes pubescens OX=154538 GN=p2ox PE=1 SV=1
sp|P79076|P2OX_TRAVE	1.77e-139	2	573	43	609	Pyranose 2-oxidase OS=Trametes versicolor OX=5325 GN=P2OX PE=1 SV=1
sp|Q8J136|P2OX_PENSG	9.97e-139	2	575	43	611	Pyranose 2-oxidase OS=Peniophora sp. (strain SG) OX=204723 GN=p2ox PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000051	0.000000

TMHMM  Annotations     

There is no transmembrane helices in KAF7621951.1.