CAZyme Information: KAF7621921.1

Basic Information

• Species: Aspergillus flavus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus flavus
• CAZyme ID: KAF7621921.1
• CAZy Family: GH16
• CAZyme Description: Galacturan 1,4-alpha-galacturonidase A [Source:UniProtKB/TrEMBL;Acc:A0A7G5JGC5]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
437		48054.54	5.0598

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AflavusNRRL3357	14313	332952	0	14313

• Gene Location: location=AAIH03000170:311053-312510(+)

Full Sequence      

MKLSGSSALLLLGFGLLGHASPLVHVQGKNCTVKPLGHGQDDVPNILHAVEKCGQTPGGR
ISLPAPYTYRINQRMTTHLESSTLEVGGMLLFSDDITYWVNNSYRIDFQNQSTAWRITGH
DYVVDGGPERGGIDGNGQLWYTWAKGGSNVFGRPMPLHVLNSTRAVLRNIAIRQPQFWAV
LVESSSHVELDNFYVNATNSDPNATEDTVWIQNTDGIDTYRSDHVTITNWVYEGGDDAVA
FKPNSTNIHVENVTVYGGPGIAFGSLGQYPDRYDIVENITVKNANFQPSSQRAMNSGIYF
KSWIGVNFGVPPNGGGNGHGYVRNVTVEDITFKDVQLPIYIDTCLSYLFDQNVTQYCDTS
TFRFDDLHFRNISGNGLATPTNYTGRNITFAVSMICSKEAPCTDITFEDVDIKLPESYSG
KSVLCENAGVQGLECNS

Enzyme Prediction     

No EC number prediction in KAF7621921.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	51	428	5.9e-75	0.9661538461538461

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395231	Glyco_hydro_28	1.09e-27	131	428	61	315	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
177865	PLN02218	1.31e-22	124	430	160	420	polygalacturonase ADPG
215120	PLN02188	1.37e-22	124	428	126	390	polygalacturonase/glycoside hydrolase family protein
178580	PLN03003	1.83e-20	123	435	116	388	Probable polygalacturonase At3g15720
215426	PLN02793	3.02e-19	124	421	147	400	Probable polygalacturonase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD93508.1|GH28	0.0	1	437	1	437
BAE56683.1|GH28	0.0	1	437	1	437
QMW34667.1|GH28	0.0	1	437	1	437
QMW46734.1|GH28	0.0	1	437	1	437
UDD63628.1|GH28	0.0	1	437	1	437

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4C2L_A	1.20e-28	41	437	30	384	Crystal structure of endo-xylogalacturonan hydrolase from Aspergillus tubingensis [Aspergillus tubingensis]
1RMG_A	1.19e-07	16	428	2	353	Rhamnogalacturonase A From Aspergillus Aculeatus [Aspergillus aculeatus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B8NJB0|RGXA_ASPFN	0.0	1	437	1	437	Putative galacturan 1,4-alpha-galacturonidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=rgxA PE=3 SV=2
sp|Q2UP32|RGXA_ASPOR	0.0	1	437	1	437	Putative galacturan 1,4-alpha-galacturonidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=rgxA PE=3 SV=1
sp|Q2EQQ2|RGXA_ASPNG	4.16e-263	13	437	14	438	Putative galacturan 1,4-alpha-galacturonidase A OS=Aspergillus niger OX=5061 GN=rgxA PE=2 SV=1
sp|A2QBB4|RGXA_ASPNC	2.79e-261	13	437	14	438	Putative galacturan 1,4-alpha-galacturonidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=rgxA PE=2 SV=2
sp|A2QG68|RGXB_ASPNC	5.31e-72	31	435	34	415	Alpha-L-rhamnosidase rgxB OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=rgxB PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000202	0.999760	CS pos: 20-21. Pr: 0.9837

TMHMM  Annotations     

There is no transmembrane helices in KAF7621921.1.