CAZyme Information: KAF7621284.1

Basic Information

• Species: Aspergillus flavus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus flavus
• CAZyme ID: KAF7621284.1
• CAZy Family: GH135
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
421	AAIH03000173|CGC8	44987.16	5.9757

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AflavusNRRL3357	14313	332952	0	14313

• Gene Location: location=AAIH03000173:574458-576029(+)

Full Sequence      

MFLSRVFCVLAALACVSAARETCVVPAGGSNATDDAPAIVHAFKKCGRGGKVVFKPTTYH
IGSVMNITWLEDVDIDLGGTLLWGTNIQYWLNHSLPVGYQNQSTAFILGGNNVRIDGHGI
GTLDGNGDTWYQWIKEQPNTSNYPGRPHAITFNGLTNSVVRGLRFLRSQMWTMSIIYSHH
VEFDSILVNNTGNVVSSSNTDGADTIRSSHITFNNWTVYNGDDSISLKGNSTDITITNSN
LYNGLGIALGSIGQYKDQFETIERLKVSNVNFHNTLHAIYVKTWTADQNGYPPNGGGGGL
GYISDVTAKDLKATSLRGAAFAISQCTRFSGAPGEGNCTNSEFQVRDISVLNLSGTTESN
RVASLQCSAVAPCTDIALSGINLELKNGTAASEYLCGNVENQKGFECTGAVCEGGSATGE
C

Enzyme Prediction     

No EC number prediction in KAF7621284.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	49	402	6.2e-64	0.9569230769230769

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
215120	PLN02188	1.09e-25	27	399	44	390	polygalacturonase/glycoside hydrolase family protein
395231	Glyco_hydro_28	9.32e-25	109	384	49	304	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
177865	PLN02218	3.51e-23	27	402	75	423	polygalacturonase ADPG
215426	PLN02793	9.94e-19	73	388	111	399	Probable polygalacturonase
227721	Pgu1	2.21e-16	8	283	66	377	Polygalacturonase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD90865.1|GH28	7.16e-315	1	421	1	421
UDD60769.1|GH28	1.68e-313	1	421	1	421
QMW31813.1|GH28	1.55e-305	1	421	1	414
BAE61240.1|GH28	2.57e-304	1	421	1	414
QMW43844.1|GH28	3.65e-304	1	421	1	414

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4C2L_A	1.99e-37	19	408	15	383	Crystal structure of endo-xylogalacturonan hydrolase from Aspergillus tubingensis [Aspergillus tubingensis]
1IA5_A	7.71e-14	62	380	35	323	Polygalacturonase From Aspergillus Aculeatus [Aspergillus aculeatus],1IB4_A Crystal Structure of Polygalacturonase from Aspergillus Aculeatus at Ph4.5 [Aspergillus aculeatus],1IB4_B Crystal Structure of Polygalacturonase from Aspergillus Aculeatus at Ph4.5 [Aspergillus aculeatus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2QG68|RGXB_ASPNC	3.73e-175	19	421	30	429	Alpha-L-rhamnosidase rgxB OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=rgxB PE=2 SV=2
sp|Q2UP32|RGXA_ASPOR	5.80e-72	34	407	41	435	Putative galacturan 1,4-alpha-galacturonidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=rgxA PE=3 SV=1
sp|B8NJB0|RGXA_ASPFN	5.80e-72	34	407	41	435	Putative galacturan 1,4-alpha-galacturonidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=rgxA PE=3 SV=2
sp|Q2EQQ2|RGXA_ASPNG	9.14e-71	22	400	31	430	Putative galacturan 1,4-alpha-galacturonidase A OS=Aspergillus niger OX=5061 GN=rgxA PE=2 SV=1
sp|A2QBB4|RGXA_ASPNC	9.14e-71	22	407	31	436	Putative galacturan 1,4-alpha-galacturonidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=rgxA PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000215	0.999769	CS pos: 18-19. Pr: 0.9734

TMHMM  Annotations     

There is no transmembrane helices in KAF7621284.1.