CAZyme Information: KAF7621137.1

Basic Information

• Species: Aspergillus flavus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus flavus
• CAZyme ID: KAF7621137.1
• CAZy Family: GH131
• CAZyme Description: Beta-glucosidase [Source:UniProtKB/TrEMBL;Acc:A0A7G5J8K1]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
852	AAIH03000173|CGC7	93377.70	5.0262

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AflavusNRRL3357	14313	332952	0	14313

• Gene Location: location=AAIH03000173:209540-212098(-)

Full Sequence      

MVHHEKSAVEELLRALTLEEKVSLLAGKNMWETANIDRLGIPSLKMTDGPAGARGSKWTY
GSLTTFIPCGISLAATFDPELVQKVGSVLGEETRRKHCQVLLAPTMNLSRSPLGGRNFEG
YGEDPYLIGKVSTAIIRGIQSQGVAACMKHFIANDTETRRFNVDQTIDERTLREVYMKPF
VMALDADPLTAMVSYPKINGYHADLSPSILKPLLREELQFDRIVMSDWGGLNSTVESLIA
TTDLEMPGPAVRRGEKLLAAIAQGQIDVAKHVDPSVRRILELLDRVGLLSESSANGAVKN
DEAESEKAPDDPNFHRIAREAAQDGLVLLKNEGVLPLQPSSFEKIAILGPNARRPTAGGA
GSAAVNPFYITTPEECLTTAIRQVNPEAEIVYEQGIPFSLRPPLLGSKLTTPNGSRKGLE
VTFYAGHEFQGPPVATTYWDDSLVYLFNDGDVPESLKGTPYCYQASGIVTPQVSGWYTWS
VANTGKAKLFIDDEMIIDNSEWSRITGGFLGCSSEDRTVRMQLQAGKTYRLRVDNIVTLP
PIESFDNTLFPNVSGLRVGLAREEDEQAMLNRAVDCARSSDIAVLVVGHNKDSEGEGGDR
INMELPGQTDALVQAVCEANPNTIVVVQAASAVTMPWVNQARAIVMAWYQGQENGNALAD
ALLGHCNFSGKTPITFPRQLEDHGSHAWFPGQAANDSCEFGEQVLVGYRHFDKHGIKPLW
PFGYGLSYTRFEVTDIRLDGHMTTAPASTISIHARVSNVGEQDGSEVVQVYVSPSEQIQK
KGLVTYQKTLAGFCKVFVPVGETRDVAIQVSKEELRWYNAEARSWQLDPGRYYCFVGTSA
VDIHGELEFHLV

Enzyme Prediction     

No EC number prediction in KAF7621137.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	34	247	2.6e-62	0.9907407407407407

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	2.60e-65	28	352	47	364	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
185053	PRK15098	8.72e-64	38	851	101	764	beta-glucosidase BglX.
396478	Glyco_hydro_3_C	5.17e-46	564	728	75	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
395747	Glyco_hydro_3	1.08e-38	38	282	63	316	Glycosyl hydrolase family 3 N terminal domain.
178629	PLN03080	3.27e-29	12	810	56	742	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW31943.1|GH3	0.0	1	852	1	852
QRD91011.1|GH3	0.0	1	851	3	853
QMW43976.1|GH3	0.0	1	852	1	852
BAE61700.1|GH3	0.0	1	852	1	852
UDD60911.1|GH3	0.0	1	852	1	852

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	1.32e-154	6	849	3	834	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	1.02e-149	6	849	3	834	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	1.44e-120	9	843	5	660	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
4I3G_A	1.58e-105	7	845	52	822	Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae],4I3G_B Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae]
2X40_A	1.26e-93	9	843	4	705	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P27034|BGLS_RHIRD	1.54e-179	9	851	2	810	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1
sp|Q5BFG8|BGLB_EMENI	1.74e-179	5	851	7	838	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1
sp|Q2U8Y5|BGLI_ASPOR	1.44e-158	9	836	6	816	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1
sp|B8NDE2|BGLI_ASPFN	1.12e-157	9	832	6	812	Probable beta-glucosidase I OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglI PE=3 SV=2
sp|A1DFA8|BGLI_NEOFI	4.27e-157	9	836	6	815	Probable beta-glucosidase I OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000046	0.000001

TMHMM  Annotations     

There is no transmembrane helices in KAF7621137.1.