CAZyme Information: KAF7621091.1

Basic Information

• Species: Aspergillus flavus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus flavus
• CAZyme ID: KAF7621091.1
• CAZy Family: GH13
• CAZyme Description: Probable beta-glucosidase H [Source:UniProtKB/Swiss-Prot;Acc:B8NPL7]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
827		90797.34	6.3739

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AflavusNRRL3357	14313	332952	0	14313

• Gene Location: location=AAIH03000173:91019-93601(+)

Full Sequence      

MALDIDYVLSHISQEDKIALLAGIDFWHTHPIPELNVPSIRSTDGPNGIRGTKFFAGVPA
ACLPCGTALASTWDQNLLREVGVLIGKECLAKGAHCWLGPTINMPRSPLGGRGFESFAED
PHLAGAMAASMITGCESTGVISAVKHFVGNDQEHERRAVDVLVTQRALREIYLRPFQIVA
RDAGPGALMTSYNKINGKHVVESKEMLDMVRQEWKWNPLIMSDWLGTYTTIDSMNAGLDL
EMPGPSRYRGRYVESALQARLIKESTIDSRARKVLEFVQQASRAPVSAVETGRDYPEDRA
LNRNLCANSIVLLKNQNDILPLPKTIKKIALVGSHVRTPAISGGGSASLEPYYTVSLYDA
VSEALPHTEILYEVGAYAHKMLPVIDRLLTNAVMHFYNEPVGTERILRATQRMSKTAFQL
MDFNAPELNRGLFYATLTGDFTPDVSGVWDFGLTVFGTGLLYVDDELVVDNTTHQTRGTA
FFGKGTVQELGSKTLNAEQTYKIRIEYGSANTSPMKAIGVVHFGGGAAHLGACLHVDSAE
MVRSAVKAAAEADYTILCTGLNHEWESEGFDRSHMDLPPGIDALITSVLDVAANKTVIVN
QSGTPVTMPWADRARGIVQAWYGGNETGHGIADVIFGDVNPSGKLPLSWPVDVKHNPAYL
NYASVGGRVLYGEDVYVGYRYYEKVGREVLFPFGHGLSYTTFTVSPDVVFSQEVFRPEEP
PTAAVKIKNTGKVAGAQVLQLYISAPHSPTPRPTKELHGFTKVLLQPGEERVAHIRMDKY
ATNFWDEIEGMWKSEEGIYEALIGTSSQNILAKGTFRVDRTRYWLGL

Enzyme Prediction     

EC	3.2.1.21:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	32	243	2.9e-60	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	4.44e-81	64	810	121	757	beta-glucosidase BglX.
396478	Glyco_hydro_3_C	4.75e-59	310	699	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
224389	BglX	1.62e-58	25	336	48	364	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
395747	Glyco_hydro_3	1.31e-34	35	276	64	315	Glycosyl hydrolase family 3 N terminal domain.
178629	PLN03080	2.73e-30	8	778	56	743	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UDD60961.1|GH3	0.0	1	827	1	827
QMW31983.1|GH3	0.0	1	827	1	834
QMW44017.1|GH3	0.0	1	827	1	834
QRD91056.1|GH3	0.0	23	827	37	841
BAE61738.1|GH3	0.0	23	827	37	841

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	7.28e-246	4	827	5	845	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	6.87e-241	4	827	5	845	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	1.87e-144	1	821	1	671	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	8.97e-110	9	819	9	664	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
4I3G_A	5.48e-95	32	818	87	828	Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae],4I3G_B Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2U9M7|BGLH_ASPOR	0.0	1	827	1	827	Probable beta-glucosidase H OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglH PE=3 SV=2
sp|B0XM94|BGLH_ASPFC	0.0	4	827	6	829	Probable beta-glucosidase H OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglH PE=3 SV=1
sp|B8NPL7|BGLH_ASPFN	0.0	1	827	1	827	Probable beta-glucosidase H OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglH PE=3 SV=1
sp|A1CUR8|BGLH_ASPCL	0.0	4	827	6	829	Probable beta-glucosidase H OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglH PE=3 SV=1
sp|Q4WL79|BGLH_ASPFU	0.0	4	827	6	829	Probable beta-glucosidase H OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglH PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999734	0.000298

TMHMM  Annotations     

There is no transmembrane helices in KAF7621091.1.