CAZyme Information: KAF7620887.1

Basic Information

• Species: Aspergillus flavus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus flavus
• CAZyme ID: KAF7620887.1
• CAZy Family: GH128
• CAZyme Description: Probable beta-glucosidase C [Source:UniProtKB/Swiss-Prot;Acc:B8NGU6]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
634		70144.66	4.6818

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AflavusNRRL3357	14313	332952	0	14313

• Gene Location: location=AAIH03000181:1937668-1939572(+)

Full Sequence      

MRIDCTVASLTALASGCQALSTRPYVPRGHSLSRRDDSAPIYRDASYCIDERVDDLLARM
TIEEKAGQLFHTRLMDGPLDDEGSGNNAHNSTSNMIGEKHMTHFNLASDITNATETAEFI
NRIQELALQTRLGIPVTVSTDPRHSFTENVGTGFKAGVFSQWPESIGLAALRDPYVVRKF
AEVAKEEYIAVGIRAALHPQVDLSTEPRWARISNTWGENSTLTSELLVEYIKGFQGDKLG
PQSVKTVTKHFPGGGPVENGEDSHFAYGKNQTYPGNNLEEHLKPFKAAIAAGATEIMPYY
SRPIGTEYEPVAFSFNKRIVTELLRNELGFEGIVLTDWGLITDGYIAGQYMPARAWGVEN
LTELERAARILDAGCDQFGGEERPELIVQLVQEGTVSEDRIDVSVRRLLREKFVLGLFDN
PFVDPESAGRVVGNDYFVRLGREAQRRSYTLLSNNEDIVPLKKIEQSTKFYIEGFNASFI
ESWNYTVVDSPEEADYALLRYNAPYEPRPGGFEANMHAGSLAFNDTEKARQAKIYSTVPT
IVDIVMDRPAVIPEIIEQAKAVFASYGSDSNAFLDVVFGVSAPEGKLPFDLPSSMEAVEA
QMEDVPFDTRNPVFKFGHGLSYANPCASSSSKCS

Enzyme Prediction     

EC	3.2.1.21:5	3.2.1.38:1	3.2.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	128	377	1e-54	0.9722222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	5.87e-64	60	494	1	382	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
395747	Glyco_hydro_3	5.78e-50	61	410	1	315	Glycosyl hydrolase family 3 N terminal domain.
185053	PRK15098	1.86e-49	1	622	1	648	beta-glucosidase BglX.
178629	PLN03080	1.17e-10	199	467	156	421	Probable beta-xylosidase; Provisional
235417	PRK05337	1.56e-10	245	376	161	275	beta-hexosaminidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD86843.1|GH3	0.0	1	634	1	634
UDD62113.1|GH3	0.0	1	634	1	634
QMW30359.1|GH3	0.0	8	634	224	850
QMW42431.1|GH3	0.0	8	634	224	850
BAE59617.1|GH3	0.0	8	634	30	656

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5M6G_A	6.03e-55	7	622	13	614	Crystal structure Glucan 1,4-beta-glucosidase from Saccharopolyspora erythraea [Saccharopolyspora erythraea D]
1LQ2_A	5.67e-43	41	621	4	598	Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme Exo1 in complex with gluco-phenylimidazole [Hordeum vulgare],1X38_A crystal structure of barley beta-D-glucan glucohydrolase isoenzyme exo1 in complex with gluco-phenylimidazole [Hordeum vulgare],1X39_A Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme exo1 in complex with gluco-phenylimidazole [Hordeum vulgare]
1EX1_A	5.89e-43	41	621	4	598	Beta-d-glucan Exohydrolase From Barley [Hordeum vulgare],1IEQ_A Crystal Structure Of Barley Beta-D-Glucan Glucohydrolase Isoenzyme Exo1 [Hordeum vulgare],1IEV_A Crystal Structure Of Barley Beta-d-glucan Glucohydrolase Isoenzyme Exo1 In Complex With Cyclohexitol [Hordeum vulgare],1IEW_A Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme Exo1 in complex with 2-deoxy-2-fluoro-alpha-D-glucoside [Hordeum vulgare],1IEX_A Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme Exo1 in complex with 4I,4III,4V-S-trithiocellohexaose [Hordeum vulgare],1J8V_A Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme Exo1 in complex with 4'-nitrophenyl 3I-thiolaminaritrioside [Hordeum vulgare],3WLH_A Crystal Structure Analysis of Plant Exohydrolase [Hordeum vulgare subsp. vulgare],3WLJ_A Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme EXO1 in complex with 3-deoxy-glucose [Hordeum vulgare subsp. vulgare],3WLK_X Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme EXO1 in complex with 4-deoxy-glucose [Hordeum vulgare subsp. vulgare],3WLL_A Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme EXO1 in complex with PEG400 [Hordeum vulgare subsp. vulgare],3WLM_A Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme exo1 in complex with octyl-O-glucoside [Hordeum vulgare subsp. vulgare],3WLN_A Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme EXO1 in complex with octyl-S-glucoside [Hordeum vulgare subsp. vulgare],3WLP_A Crystal Structure Analysis of Plant Exohydrolase [Hordeum vulgare subsp. vulgare]
6JGG_A	6.17e-43	41	621	8	602	Crystal structure of barley exohydrolaseI W434F mutant in complex with methyl 2-thio-beta-sophoroside. [Hordeum vulgare subsp. vulgare],6JGK_A Crystal structure of barley exohydrolaseI W434F mutant in complex with 4I,4III,4V-S-trithiocellohexaose [Hordeum vulgare subsp. vulgare],6LBV_A Crystal structure of barley exohydrolaseI W434F mutant in complex with methyl 6-thio-beta-gentiobioside [Hordeum vulgare subsp. vulgare],6LC5_A Crystal structure of barley exohydrolaseI W434F in complex with 4'-nitrophenyl thiolaminaribioside [Hordeum vulgare subsp. vulgare]
6JGL_A	6.17e-43	41	621	8	602	Crystal structure of barley exohydrolaseI W434H mutant in complex with methyl 2-thio-beta-sophoroside [Hordeum vulgare subsp. vulgare],6JGN_A Crystal structure of barley exohydrolaseI W434H in complex with 4'-nitrophenyl thiolaminaribioside [Hordeum vulgare subsp. vulgare],6JGO_A Crystal structure of barley exohydrolaseI W434H mutant in complex with 4I,4III,4V-S-trithiocellohexaose [Hordeum vulgare subsp. vulgare],6JGP_A Crystal structure of barley exohydrolaseI W434H mutant in complex with methyl 6-thio-beta-gentiobioside. [Hordeum vulgare subsp. vulgare]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2UFP8|BGLC_ASPOR	0.0	8	634	12	638	Probable beta-glucosidase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglC PE=3 SV=2
sp|B8NGU6|BGLC_ASPFN	0.0	1	634	1	634	Probable beta-glucosidase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglC PE=3 SV=1
sp|Q5BCC6|BGLC_EMENI	0.0	1	622	1	615	Beta-glucosidase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglC PE=1 SV=1
sp|Q46684|BGLX_DICCH	3.09e-140	35	622	51	654	Periplasmic beta-glucosidase/beta-xylosidase OS=Dickeya chrysanthemi OX=556 GN=bgxA PE=3 SV=1
sp|T2KMH9|PLH34_FORAG	5.11e-44	42	624	29	640	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.005984	0.993996	CS pos: 16-17. Pr: 0.9393

TMHMM  Annotations     

There is no transmembrane helices in KAF7620887.1.