CAZyme Information: KAF7619586.1

Basic Information

• Species: Aspergillus flavus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus flavus
• CAZyme ID: KAF7619586.1
• CAZy Family: CE8
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
484		53825.77	4.9058

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AflavusNRRL3357	14313	332952	0	14313

• Gene Location: location=AAIH03000226:2870196-2871833(+)

Full Sequence      

MHFSSLSLPLTALSLVTPSLAYPQFKFEQRVARSNSSESRANAVKEAFVHAWDGYMQYAY
PHDELHPISNGVGDSRNGWGASAVDALSTAVIMGNETIVNQILDHIATIDYSKTDDQVSL
FETTIRYLGGMLSGYDLLKGPASNLVKDQAKVKTLLDQSQNLADVLKFAFDTPSGIPYNN
INITSHGNDGATTNGLAVTGTLVLEWTRLSDLTGDTEYAQLSQKAEDYLLNPHQRVQSRL
KDWSEAISTSQTELSPTDSTYGDRWVKAAESSIKHLASHPEKRPDLTFLASYNDGQYGLS
SQHLTCFDGGSFLLGGTVLDRDDFIQFGLDLVKGCHETYNQTLTGIGPESFGWDPKNVPS
DQKELYERAGFYISSGAYILRPEVIESFYYAWRITGQEIYREWVWNAFVNINKYCRTDSG
FAGLTNVNAANGGGRYDNQESFLFAEVLKYVYLTFAPDNEWQVQRGKGNKFVYNTEAHPV
RVAA

Enzyme Prediction     

EC	3.2.1.113:12	3.2.1.113:12

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH47	47	250	2.5e-61	0.43946188340807174
GH47	257	481	7.6e-60	0.484304932735426

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396217	Glyco_hydro_47	0.0	47	482	1	453	Glycosyl hydrolase family 47. Members of this family are alpha-mannosidases that catalyze the hydrolysis of the terminal 1,2-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man(9)(GlcNAc)(2).
240427	PTZ00470	1.19e-110	23	483	55	519	glycoside hydrolase family 47 protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAE57653.1|GH47|3.2.1.113	0.0	1	484	1	510
BAC07247.1|GH47|3.2.1.113	0.0	1	484	1	510
QRD82359.1|GH47	0.0	1	484	1	510
QMW39988.1|GH47	0.0	1	484	1	510
QMW27917.1|GH47	0.0	1	484	1	510

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1KKT_A	1.81e-241	7	483	6	509	Structure of P. citrinum alpha 1,2-mannosidase reveals the basis for differences in specificity of the ER and Golgi Class I enzymes [Penicillium citrinum],1KKT_B Structure of P. citrinum alpha 1,2-mannosidase reveals the basis for differences in specificity of the ER and Golgi Class I enzymes [Penicillium citrinum],1KRE_A Structure Of P. Citrinum Alpha 1,2-Mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRE_B Structure Of P. Citrinum Alpha 1,2-Mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRF_A Structure Of P. Citrinum Alpha 1,2-mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRF_B Structure Of P. Citrinum Alpha 1,2-mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum]
2RI8_A	1.26e-237	36	483	1	474	Penicillium citrinum alpha-1,2-mannosidase complex with glycerol [Penicillium citrinum],2RI8_B Penicillium citrinum alpha-1,2-mannosidase complex with glycerol [Penicillium citrinum],2RI9_A Penicillium citrinum alpha-1,2-mannosidase in complex with a substrate analog [Penicillium citrinum],2RI9_B Penicillium citrinum alpha-1,2-mannosidase in complex with a substrate analog [Penicillium citrinum]
1HCU_A	7.94e-139	33	482	8	492	Chain A, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei],1HCU_B Chain B, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei],1HCU_C Chain C, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei],1HCU_D Chain D, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei]
5KKB_A	2.32e-57	23	479	5	464	Structure of mouse Golgi alpha-1,2-mannosidase IA and Man9GlcNAc2-PA complex [Mus musculus],5KKB_B Structure of mouse Golgi alpha-1,2-mannosidase IA and Man9GlcNAc2-PA complex [Mus musculus]
1NXC_A	2.83e-57	23	479	3	462	Structure of mouse Golgi alpha-1,2-mannosidase IA reveals the molecular basis for substrate specificity among Class I enzymes (family 47 glycosidases) [Mus musculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B8N417|MNS1B_ASPFN	0.0	1	484	1	510	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=mns1B PE=3 SV=2
sp|Q2ULB2|MNS1B_ASPOR	0.0	1	484	1	510	Mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=mns1B PE=1 SV=1
sp|Q0D076|MNS1B_ASPTN	8.63e-269	1	482	1	507	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mns1B PE=3 SV=1
sp|A2QAS2|MNS1B_ASPNC	1.39e-259	1	484	1	512	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=mns1B PE=3 SV=1
sp|Q12563|MNS1B_ASPPH	1.88e-257	1	484	1	512	Mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus phoenicis OX=5063 GN=mns1B PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.001122	0.998840	CS pos: 21-22. Pr: 0.9757

TMHMM  Annotations     

There is no transmembrane helices in KAF7619586.1.