CAZyme Information: KAF7619116.1

Basic Information

• Species: Aspergillus flavus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus flavus
• CAZyme ID: KAF7619116.1
• CAZy Family: CE3
• CAZyme Description: Endo-1,3(4)-beta-glucanase [Source:UniProtKB/TrEMBL;Acc:B8N3J2]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
910		97890.96	5.7885

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AflavusNRRL3357	14313	332952	0	14313

• Gene Location: location=AAIH03000226:1647661-1650673(+)

Full Sequence      

MQSRSRWQSAFILTGLLVAETVYSAPTPTQEATTSFKTQYPPSAANARLLLPETQGYYPT
SLEREGHQLQKPTPDPKEVPYRFGGPINDLYGPVSLLEGLLPGLLPATSDAPSTAPAETP
VPSVTLPSQETINGPAEATSSPTTAPTSISVPVSTSSSSTSSLTSHSAKPQDTSTSVESI
PATSTIMATMANGQDVFLPVSTGPIPGTVKSRNDHPVPRASIMNNTDPIETNKFYAGLFL
GTQTNTTFTHPYGIAWAKGNGNAKSYGMAISHIEADKLALGPKNDKIPGSPVQYYVNPIG
IQSIILSATELGGSTVLMTENPLPFSANAVLQPQSGSSERITFPVVQGMGFVTGIYSNLQ
PVIQSSVFFSKVVSAGSPRPGIFKYTVDLADGTNWLLYLTSNDGKDPNLHLESTTNLRGP
PGWSGTVQVAKNPAGTLGEKLFDNSSGVYATQGWVKGAVSGQTGTYSLTWGKEGKDKDGT
PLMMYALPHHVESFDKTTHDRLTNITMRTTTKGNATAVIGETWSMVEQDLPVGMGFAPWS
VSAGSVDTISPAAQKVIIDVAPTELQQDVGNQSNLNSMYYSGKALSKFATLVYAVDKLGG
KPDLAAPALKDLKTAFARFIDNKQQFPLVYDNVWKGVVSSASYDGGDSGADFGNTYYNDH
HFHYGYFIHAAAIIGSLDPSWIQGNKDWVNMLVRDAGNAATNDPLFPFSRGFDWFHGHSW
AKGLFESFDGKDEESTSEDAMFAYALKMWGKTIGDASMEARGNLMLGILRRSLHNYFLLE
ADNKNHPPVFVPNKVTGILFENKVDHTTYFGANLEYIHGIHMLPLLPVSPYTRSQKFVKE
EWDALFATNAAAPAEQVQAGWKGVLYANLALIDPVSAWNFFAQPNFDYSVIDGGATRIWY
LALAAGLGGA

Enzyme Prediction     

EC	3.2.1.39:20

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	213	902	3.8e-228	0.9919614147909968

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407548	Glyco_hydro81C	0.0	548	900	1	348	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
227785	Acf2	0.0	173	900	36	748	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
397619	Glyco_hydro_81	2.25e-155	215	540	1	320	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD82801.1|GH81	0.0	1	910	1	910
QMW28320.1|GH81	0.0	1	910	1	910
QMW40391.1|GH81	0.0	1	910	1	910
UDD56325.1|GH81	0.0	187	910	1	724
BAE58039.1|GH81	0.0	187	906	1	720

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K3A_A	2.86e-106	191	905	3	716	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	5.16e-106	191	905	28	741	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K35_A	1.13e-103	191	905	3	716	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
6FOP_A	1.23e-27	579	883	340	636	Chain A, Glycoside hydrolase family 81 [Acetivibrio thermocellus ATCC 27405]
5V1W_A	2.78e-22	579	898	361	675	Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4AZ24|ENG1_ARTBC	0.0	167	906	163	901	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|Q09850|ENG2_SCHPO	1.12e-182	195	909	2	704	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|P53753|ENG1_YEAST	3.85e-165	195	907	401	1112	Endo-1,3(4)-beta-glucanase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSE4 PE=1 SV=1
sp|Q9UT45|ENG1_SCHPO	4.04e-162	215	907	66	737	Primary septum endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng1 PE=3 SV=1
sp|Q5AIR7|ENG1_CANAL	3.24e-157	195	906	427	1140	Endo-1,3(4)-beta-glucanase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ENG1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000397	0.999567	CS pos: 24-25. Pr: 0.9746

TMHMM  Annotations     

There is no transmembrane helices in KAF7619116.1.