CAZyme Information: KAF7618934.1

Basic Information

• Species: Aspergillus flavus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus flavus
• CAZyme ID: KAF7618934.1
• CAZy Family: CE12
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
454		49834.30	8.6987

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AflavusNRRL3357	14313	332952	0	14313

• Gene Location: location=AAIH03000226:1185430-1186897(+)

Full Sequence      

MAAGLALARPNLLNPNNPIRSLSLAFWLWKAFVFLIIIGCPGPGYDTSTGLLPYQESAAS
GAKLEAIRHAPFSFPLKLVRWDSIYFVHIVRDDYVFEQEWAFGYGYTRILSFLTSGKVLP
QFSGLDGVARVALIAVALSHIAHYFSVLALYRLSINIFGHDNTSGALISFLSATLHIICP
AGAFLSAPYGESLFSFLNITGYFLYSSSLLDANAGKRASSDAKLLLAAALFSIATAVRSN
GILSGALFAFDALLQLRKIFTQGISGDILLRLGVIVVGGCVIALGLIVPQWIAYTTFCMS
DEPLRPWCEQLIPSIYGWVQVHYWNVGFLRYWTLSNLPLFILAFPMLFLMCRSSIWALNT
AWPSDTATAVLTRLAAPNGLLAVMAFTSYHVQIINRISSGYPLWYWYIICQLSSHVADSS
SVVKRSQTFSIAIQGMVIYAIVQAVLFGSFLPPA

Enzyme Prediction     

No EC number prediction in KAF7618934.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT76	26	454	1.2e-107	0.9877149877149877

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
282094	Mannosyl_trans2	2.18e-33	78	454	57	439	Mannosyltransferase (PIG-V). This is a family of eukaryotic ER membrane proteins that are involved in the synthesis of glycosylphosphatidylinositol (GPI), a glycolipid that anchors many proteins to the eukaryotic cell surface. Proteins in this family are involved in transferring the second mannose in the biosynthetic pathway of GPI.
227829	COG5542	6.07e-16	80	454	76	408	Mannosyltransferase related to Gpi18 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD82967.1|GT76	0.0	1	454	1	452
QMW28463.1|GT76	0.0	1	454	1	452
QMW40534.1|GT76	0.0	1	454	1	452
BAE58188.1|GT76	1.66e-309	1	454	1	434
UDD56494.1|GT76	1.46e-234	118	454	14	350

PDB Hits     

KAF7618934.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2UJS7|GPI18_ASPOR	2.94e-310	1	454	1	434	GPI mannosyltransferase 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=gpi18 PE=3 SV=1
sp|Q4WQ21|GPI18_ASPFU	3.45e-155	12	454	23	441	GPI mannosyltransferase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gpi18 PE=3 SV=1
sp|Q2GSI6|GPI18_CHAGB	2.55e-90	16	454	16	471	GPI mannosyltransferase 2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) OX=306901 GN=GPI18 PE=3 SV=1
sp|Q4I0K3|GPI18_GIBZE	1.04e-82	11	454	2	423	GPI mannosyltransferase 2 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI18 PE=3 SV=1
sp|Q6C216|GPI18_YARLI	1.36e-44	21	454	6	357	GPI mannosyltransferase 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=GPI18 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.993219	0.006794

TMHMM  Annotations     

Start	End
21	43
131	153
165	187
226	248
269	291
328	350
429	451