CAZyme Information: KAF7618815.1

Basic Information

• Species: Aspergillus flavus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus flavus
• CAZyme ID: KAF7618815.1
• CAZy Family: GT90
• CAZyme Description: Glycosyltransferase family 31 protein [Source:UniProtKB/TrEMBL;Acc:B8N0T2]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
485	AAIH03000226|CGC23	55415.75	5.4505

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AflavusNRRL3357	14313	332952	0	14313

• Gene Location: location=AAIH03000226:874901-876358(-)

Full Sequence      

MLAKVGEKPPAMGASRVWKKKILRFTVVLCLVSAFAFFLWPEIEPQEPTADTVSNITITS
SVQCEPDFDALRRLDVHKLSEYTRREVIAVPSSNDALPVRQNLQTPLFERKSSDDVDRLS
TQQLQDNCMIPEPVTVQVLQPPRNVDASHIDFGVATTLGRLNESLDAFSHWAGYTKARIF
ALIEPDKDKRTHEVQAKADSLGINLYITENDEEYQRRYFTLVSHLGKHMRPQTRWSCIID
DDTFFLSMSELVKALAEYDDTQPTYVGGLSESIPQIGVFGLMGFGGAGVFLSRPLVEEIS
KPEVFEACLNTDHTGDRRISLCIYQHTYTHLTINHRLHQLDVQGDVSGFFESGRQPPLSV
HHWKSWFHMDMAKLSVVSELCGDSCLLRQWKFADGWILTNGFSVMKYSKELDPNDKTMEL
TWEGQNGAVHESFLHEFGPLREKDWDKFSYVLEDSVVDGNKVRQWYVHRDAEKGDQILEL
IWRAQ

Enzyme Prediction     

No EC number prediction in KAF7618815.1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
215605	PLN03153	6.41e-14	231	362	209	341	hypothetical protein; Provisional
367085	Fringe	2.58e-08	201	296	51	156	Fringe-like. The drosophila protein fringe (FNG) is a glucosaminyltransferase that controls the response of the Notch receptor to specific ligands. FNG is localized to the Golgi apparatus (not secreted as previously thought). Modification of Notch occurs through glycosylation by FNG. The xenopus homolog, lunatic fringe, has been implicated in a variety of functions.
398362	DUF604	6.89e-08	282	362	9	90	Protein of unknown function, DUF604. This family includes a conserved region found in several uncharacterized plant proteins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD83076.1|GT31	0.0	1	485	1	485
QMW28562.1|GT31	0.0	1	485	1	485
QMW40633.1|GT31	0.0	1	485	1	485
BAE58287.1|GT31	0.0	1	485	1	485
UDD56605.1|GT31	0.0	1	485	1	485

PDB Hits     

KAF7618815.1 has no PDB hit.

Swiss-Prot Hits     

KAF7618815.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000019	0.000012

TMHMM  Annotations     

Start	End
21	40