CAZyme Information: KAF7618666.1

Basic Information

• Species: Aspergillus flavus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus flavus
• CAZyme ID: KAF7618666.1
• CAZy Family: GT71
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
709		75586.02	4.1594

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AflavusNRRL3357	14313	332952	0	14313

• Gene Location: location=AAIH03000226:471945-474606(-)

Full Sequence      

MQSYSLITILGLASATLIIGQQFKWYSYPWYTLNLTQACFTAINSSVPSCPSLLATHTTG
TGTGDVMVYDNIAYPATFMIDNPLYTYDVSCYKDSSPGKYCDLILGEWRNQTNATNDDSS
AHDCSDCILGPFKIQLESPIGYDDEWAEDFISLTSSCGATGYTYVAPTGYALNSSITSSG
TATSTGTGSDAATPTSTHTCATTYTVQANDTCHSIAKKHSVSTYNLMVANGITIFCSNLA
APGESICIPESCNSTTLLAGNSCAQMMCDWNVSMAQILAWNSIISSLCDNFHLFYGWEIC
RGPPGGAIEVPTGAPTTTSGPTATGVVYSTPAPVPTNAMAGYNHRCGKWYTTKYNDSCTD
IAANSGIPYEEWLFLNPDVFANCTNLWDGYAYCVGAVGNVATYSGWTVTAAPTTSFTRPA
STTETWTPGPAYILPHAPGTLQDCAVYRDAIDANNNPTKEWGLGTDFLDGLGINYTACSF
YSHPYSVTVDDFVQWNPSLDVSDCVVHKGYSYCVLISYNHTSSDPPDDMPVETKCDTVDK
AWIMKGTASDCNCYYVIRGKEAEGFECSSITEGSDLSEAKLVELNPWIGTGDCSTGLFAG
LEGEEQRAVCLGTGPLSSSTTTSPTRATSPVTPTIGTSTSLAPSATVTPQPGAIKTCNAY
HVVKSGDECATIAEANGISLETFYKWNPQVGSDCRTLWLGYGVCVGVSS

Enzyme Prediction     

No EC number prediction in KAF7618666.1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
180536	PRK06347	2.92e-11	142	427	258	551	1,4-beta-N-acetylmuramoylhydrolase.
212030	LysM	6.51e-09	660	701	2	43	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
396179	LysM	7.52e-07	204	249	1	43	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.
197609	LysM	1.38e-06	660	705	1	44	Lysin motif.
212030	LysM	1.39e-06	202	248	1	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW40759.1|CBM50	0.0	1	709	1	744
QRD83217.1|CBM50	0.0	67	709	1	643
QMW28689.1|CBM50	0.0	67	709	1	643
UDD56742.1|CBM50	0.0	79	709	1	631
UNI22107.1|CBM50	1.98e-140	12	706	9	687

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4PXV_A	5.30e-07	657	705	2	47	Crystal Structure of LysM domain from pteris ryukyuensis chitinase A [Pteris ryukyuensis],4PXV_B Crystal Structure of LysM domain from pteris ryukyuensis chitinase A [Pteris ryukyuensis],4PXV_C Crystal Structure of LysM domain from pteris ryukyuensis chitinase A [Pteris ryukyuensis],4PXV_D Crystal Structure of LysM domain from pteris ryukyuensis chitinase A [Pteris ryukyuensis],5YLG_A Crystal Structure of LysM domain from pteris ryukyuensis chitinase A [Pteris ryukyuensis],5YLG_B Crystal Structure of LysM domain from pteris ryukyuensis chitinase A [Pteris ryukyuensis],5YLG_C Crystal Structure of LysM domain from pteris ryukyuensis chitinase A [Pteris ryukyuensis],5YLG_D Crystal Structure of LysM domain from pteris ryukyuensis chitinase A [Pteris ryukyuensis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4AVW3|LYSM5_ARTBC	9.96e-29	283	709	206	538	LysM domain-containing protein ARB_00327 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_00327 PE=3 SV=2
sp|D4B5F9|PGDA_ARTBC	2.77e-16	650	707	380	437	Probable peptidoglycan-N-acetylglucosamine deacetylase ARB_03699 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_03699 PE=1 SV=2
sp|D4ALG0|LYSM1_ARTBC	4.09e-15	376	707	98	373	LysM domain-containing protein ARB_05157 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_05157 PE=1 SV=1
sp|D4B4P8|LYSM2_ARTBC	1.54e-10	567	707	41	181	LysM domain-containing protein ARB_03438 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_03438 PE=3 SV=1
sp|D4AY86|LYSM6_ARTBC	1.05e-07	303	397	333	422	LysM domain-containing protein ARB_01155/01156 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01155/01156 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000261	0.999698	CS pos: 20-21. Pr: 0.9771

TMHMM  Annotations     

There is no transmembrane helices in KAF7618666.1.