CAZyme Information: KAF7618608.1

Basic Information

• Species: Aspergillus flavus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus flavus
• CAZyme ID: KAF7618608.1
• CAZy Family: CBM50|CBM50
• CAZyme Description: Glucose-methanol-choline (Gmc) oxidoreductase, putative [Source:UniProtKB/TrEMBL;Acc:B8N0H4]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
618		67680.97	7.0521

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AflavusNRRL3357	14313	332952	0	14313

• Gene Location: location=AAIH03000226:333860-335976(-)

Full Sequence      

MPHPVLLFLIALHWCLIHTLAVPTFNGQSAVSDDLLRDGRFDYVVVGGGTAGIVVATRLA
QRSYTVALIEAGGFYEYQSLAAIPLGDIIPVGSDPRNKFSIDWGFVTENQPGANNRPIHY
ARGKCLGGSSALNFMIYQRPTRGAMERWATAVGDSSYTFDRVLPYFKRSVQFTPPNQLTR
FPNSTPSFDPAAYDPQGGPLHASYSNYAMPFSSWMRLAMNALGIRDRDEFNLGSLLGAQY
CTSTIRPRDQKRSSSESSFLETKPPLLTTYTYVLAKKILFDSQKRATGVLAKSKLGEFRL
HADKEVIVSAGAFQSPQLLMVSGIGPAKTLEDHGIPVLADRPGVGQNMWDHPLFAPSYRV
GMPTASTVVTSISYLLRQAANAAIFRQGPFTSPITDYLGWEKIPTSLRANFSRETLQDLA
RFPDDWPEAEYLSAAAYVGDVSKPVLIQPRDGYDYASIVGVLVAPTSRGNVTIRSADTFD
LPTINPNWLSTETDQEVAIATFKRTRQAFESGAMAPILIGDEYYPGDRVQSNAEILEFVK
DNMMTIWHAACTCKMGTAKDAMAVVDSHARVFGVDGLRVVDASAFPLLPPGHPQSVVYML
AEKISDAIAAANGTTERR

Enzyme Prediction     

No EC number prediction in KAF7618608.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	40	609	1.4e-180	0.9929577464788732

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	1.34e-113	40	608	5	531	choline dehydrogenase; Validated
225186	BetA	8.85e-104	37	613	4	538	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	4.11e-42	465	604	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	1.94e-40	7	600	5	568	Protein HOTHEAD
366272	GMC_oxred_N	5.72e-28	113	352	14	217	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW28742.1|AA3_2	0.0	1	618	1	618
QRD83278.1|AA3_2	0.0	1	618	1	618
UDD56803.1|AA3_2	0.0	1	618	1	618
QMW40815.1|AA3_2	0.0	1	618	1	618
UCK58435.1|AA3_2	6.49e-290	17	608	16	612

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5OC1_A	1.55e-60	41	610	2	563	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	8.10e-60	41	610	3	564	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
6ZE2_A	8.95e-56	40	608	5	582	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
3NNE_A	1.72e-53	36	611	9	529	Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_B Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_C Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_D Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_E Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_F Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_G Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_H Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis]
2JBV_A	1.72e-53	36	611	9	529	Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],2JBV_B Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],4MJW_A Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis],4MJW_B Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1CFL2|PATE_ASPCL	1.11e-186	41	611	51	627	Patulin synthase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=patE PE=1 SV=1
sp|A0A075TRK9|PATE_PENEN	6.28e-186	37	609	48	625	Patulin synthase OS=Penicillium expansum OX=27334 GN=patE PE=1 SV=1
sp|Q5B8A1|PKFF_EMENI	1.69e-173	21	612	17	611	Dehydrogenase pkfF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pkfF PE=2 SV=1
sp|A0A1U8QYA8|CICC_EMENI	2.47e-170	19	610	13	609	Oxidoreductase cicC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=cicC PE=1 SV=1
sp|Q0CJ60|ATC_ASPTN	1.60e-144	35	608	40	593	Cyclase atC OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=atC PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.005118	0.994871	CS pos: 21-22. Pr: 0.9564

TMHMM  Annotations     

There is no transmembrane helices in KAF7618608.1.