CAZyme Information: KAF7618515.1

Basic Information

• Species: Aspergillus flavus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus flavus
• CAZyme ID: KAF7618515.1
• CAZy Family: AA9
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
374	AAIH03000226|CGC15	40100.11	7.9804

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AflavusNRRL3357	14313	332952	0	14313

• Gene Location: location=AAIH03000226:109660-110951(+)

Full Sequence      

MGPLAKPLIHELSRQDAIQSALVISTHDEVNKPTRARQLHDPTRLSFTMYRFLVSLLGLV
AGTTYAAPVPEVSSMNAVRNGPPPGCLTVGPAGQHHTVGAALSALGSSPSPACIYIAQGT
YKEKVVINYKGALTLYGETSDTSSYKGNAVTITHTISSDDAGTLDDSATLQVKSNDFNMY
NINVVNGYGPGKQALALSADANHLGFYGCQFRGYQDTVFTKTGTQFFSKCLIQGSVDYIF
GGGSAWFHQCDIRSTAPGYITASGREKADNSWLAFDHCTISGASGVDLKEKVFLGRPWRP
LARVIYQNSDLSDVVSPKGWSPMAKGATPLFYEFKNTGAGSNTSKREFLSPIAAAVTRES
VLGNDAAQWVDARY

Enzyme Prediction     

EC	3.1.1.11:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	92	348	4.1e-80	0.8958333333333334

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395871	Pectinesterase	1.32e-57	93	346	10	271	Pectinesterase.
215357	PLN02665	1.71e-47	114	346	100	333	pectinesterase family protein
178051	PLN02432	1.11e-43	93	346	21	265	putative pectinesterase
178372	PLN02773	3.57e-43	82	346	2	275	pectinesterase
178606	PLN03043	5.95e-43	87	346	225	497	Probable pectinesterase/pectinesterase inhibitor; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW28822.1|CE8	1.39e-240	49	374	1	326
QRD83366.1|CE8	1.39e-240	49	374	1	326
QMW40897.1|CE8	1.14e-239	49	374	1	326
BAE58553.1|CE8	5.00e-236	49	374	1	325
UDD56893.1|CE8	2.82e-234	49	374	1	339

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C1C_A	8.78e-131	79	374	3	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
5C1E_A	8.78e-131	79	374	3	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
1XG2_A	1.79e-28	93	346	13	274	Chain A, Pectinesterase 1 [Solanum lycopersicum]
1GQ8_A	6.78e-28	88	346	4	278	Pectin methylesterase from Carrot [Daucus carota]
2NSP_A	1.26e-19	97	364	20	336	Chain A, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1DBT4|PMEA_NEOFI	8.62e-134	53	374	7	324	Probable pectinesterase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=pmeA PE=3 SV=1
sp|Q4WBT5|PMEA_ASPFU	4.94e-133	58	374	14	324	Probable pectinesterase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=pmeA PE=3 SV=1
sp|B0Y9F9|PMEA_ASPFC	4.94e-133	58	374	14	324	Probable pectinesterase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=pmeA PE=3 SV=1
sp|A2QK82|PMEA_ASPNC	5.49e-133	52	374	5	327	Probable pectinesterase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=pmeA PE=3 SV=1
sp|Q5B7U0|PMEA_EMENI	1.48e-127	54	374	7	325	Pectinesterase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pmeA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.997964	0.002028

TMHMM  Annotations     

There is no transmembrane helices in KAF7618515.1.