CAZyme Information: KAF7617806.1

Basic Information

• Species: Aspergillus flavus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus flavus
• CAZyme ID: KAF7617806.1
• CAZy Family: AA7
• CAZyme Description: Cellulase domain-containing protein [Source:UniProtKB/TrEMBL;Acc:B8N8I5]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
406		46483.58	4.4024

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AflavusNRRL3357	14313	332952	0	14313

• Gene Location: location=AAIH03000235:952193-953645(-)

Full Sequence      

MRLQSLIVLLGTAPLALAWLPTDQGRSLSTFTNTNTTKIRGVNLGSHFIMEKWMASSEWS
SMGCGDYKSEWDCVKGIGQEAANAAFKTHWQTWITKDDITRMVSYGLNTIRIPVGFWMYE
DLINDTEYYPRNNSIEDLTNVCQWASDADMYIIIDLHGLPGAQEPNQPFTGRYVDPPQFY
QSDDNAERAYKFYEWIREQIHNNRSAFKNVGALELVNEPLQNTENADTNWMVEHFYPSAI
DRIRAKESVLGVSDADALHVTLMDDKWDSGGNPTRSLNDTQKEKLLFDDHNYEIYLVRNA
ETIDDMITDACGDNRTSNVSPKVVGEWSLAFDNTGDNFLPMTGDHAKSYSKWFSAQQRQY
EALDGWVFWSWKTDTVPNIEQWNYQKAVDAGIISKDLNAQYDQNPC

Enzyme Prediction     

EC	3.2.1.75:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	78	384	3.1e-96	0.9933333333333333

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	5.79e-19	38	391	17	379	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
395098	Cellulase	1.73e-12	88	371	14	268	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD85480.1|GH5_15	3.13e-315	1	406	1	406
QMW29183.1|GH5_15	3.13e-315	1	406	1	406
QMW41257.1|GH5_15	8.94e-315	1	406	1	406
UDD58908.1|GH5_15	3.64e-314	1	406	1	406
EAA59985.1|GH5_15|3.2.1.75	4.09e-123	3	406	1	409

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EQP_A	1.63e-36	39	406	9	391	Exo-b-(1,3)-glucanase From Candida Albicans [Candida albicans]
3O6A_A	4.75e-36	39	406	14	396	F144Y/F258Y Double Mutant of Exo-beta-1,3-glucanase from Candida albicans at 2 A [Candida albicans]
1CZ1_A	6.02e-36	39	406	9	391	Exo-b-(1,3)-glucanase From Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]
2PB1_A	6.70e-36	39	406	15	397	Exo-B-(1,3)-Glucanase from Candida Albicans in complex with unhydrolysed and covalently linked 2,4-dinitrophenyl-2-deoxy-2-fluoro-B-D-glucopyranoside at 1.9 A [Candida albicans]
2PC8_A	1.78e-35	39	406	15	397	Chain A, Hypothetical protein XOG1 [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5B6Q3|EXGB_EMENI	7.26e-124	3	406	1	409	Glucan endo-1,6-beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=exgB PE=2 SV=1
sp|A1DGM6|EXGB_NEOFI	2.87e-113	2	399	4	392	Probable glucan endo-1,6-beta-glucosidase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=exgB PE=3 SV=1
sp|B0XRX9|EXGB_ASPFC	1.20e-108	15	385	14	378	Probable glucan endo-1,6-beta-glucosidase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=exgB PE=3 SV=1
sp|Q0C8Z0|EXGB_ASPTN	4.38e-108	7	406	9	403	Probable glucan endo-1,6-beta-glucosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=exgB PE=3 SV=1
sp|Q4X1N4|EXGB_ASPFU	1.36e-107	15	385	14	378	Probable glucan endo-1,6-beta-glucosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=exgB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000223	0.999771	CS pos: 18-19. Pr: 0.9784

TMHMM  Annotations     

There is no transmembrane helices in KAF7617806.1.