CAZyme Information: KAF7617384.1

Basic Information

• Species: Aspergillus flavus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus flavus
• CAZyme ID: KAF7617384.1
• CAZy Family: AA7
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1415	AAIH03000265|CGC16	155948.58	5.1014

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AflavusNRRL3357	14313	332952	0	14313

• Gene Location: location=AAIH03000265:2359365-2364611(+)

Full Sequence      

MRVDRGMHHMVHLCIIGLALLACTLALPSPTEQQQTSTLVDGVPGLEARDAKPFALRIMP
LGASITTGLKSSDKNGYRIWIREQLRHAGWEVNMVGSLKSGTMRDNDNEGWSGWIIDEVA
KEAEKTIPKAPNLILINAGTNDAVRGVDVDRAGERMNVLLTRLYEGIPGTTIILSTLLSN
ADPKAQANVLKINEQYRNIAAARRKNGDKIVLAEMSDFIKVSELVDGTHPTDFGYKKMAS
VWWAAIQEAESAKFLSKPKDIGESDWAYTTCEKKFGSGNDGGKIQTQRGSGWDDGDYKHN
SQSMGRIMQIGSSDSKDDTYGGINYAQLVNLGGAHREGALDELVWTEDGVGTWMYLNNNN
GNFGKRVAIDVKDNCLARGVRWGDLNNDGLDDFICISREGAMYASINQGGNPPQFKYIGL
VREAPGGGLAQANVRLGDIDGDGRIDYCLVKGNGDIQCWRNGGQKDAPTKEFNGYWQDLG
TVFTGKGMGDIAGVRLVDINGDFRSDWLWLDDEGKVTTYINQRGTGKGSLAPDWRRIGVT
HAGMGVKGARDRIKFGQVYPHGGADYVYVESLENGKSYNHHTAVWKNIGKGGTTLKGDGD
FYCDWRGTGADDYIWISPTGRALLYGNIHKPPTWVPEGPQIFDLGRERKGIHLADFNGDG
KCDVWAVNRETGAAEVWINHWNEDTSSGFLDYRGVVTGDVKCTEGWGVGYRDIGVRMADL
DGDGRADYLCMEPNGRTVGWLNKGENKFEYKSQVKRTHGYDRANHVWADVDGDGLVDFLW
VDKFNGNTKVWINKGAIPTAGSSYKWELLDGPRYQGSDRGANLYFPNLGGLGRADMHNVI
PRSNIAYTWFNTCPGSDSTAVDDVDPSIDPDLPPYTAPGQPTPTGTPPVSPTATGVPIGE
APDGYYEHWPLNDKDRMESVCNHLDELDKALWNKNDMGNWVTTTAGWYQKLSLNPDLNLD
PENPFKWPGGLANALAKYNGSREEVPAPYSWECVNVRADCEVKHLEDVDPCKQGRMYRVQ
ALTAVHNLAQYLKVMYSMMAEIWTNAGFENAGLVLRYSHKGDDNIEFGEDAGMTIGAGFA
SIMGAFFLTPMAGVAAGAMTIGAGAVAALGGPTPADLKFNTYADLGRKSAAMHDAMTKSL
DTFYNSLFFKKPPTDPNWVTSPTALPRILNTGNFASHKSVVAPTDEETRKYSMVPEKDGL
VKYVVAPLINMLWEKDLYFIVKIDNNSIRSSDGRKYHPCDKNGDMSENTDTTDRKWCNPD
GTAFFFYRLGSNDHVPKGMDKLPDDYGFNGYDVARSSYLVQRTTNEWQSKVNTDSYFSWV
PQTSGTDIPAWQMMRWNLPVCDLAEYGVEEDCGSGLLWDVCMYAAVKEVCGRKDGWPKDY
DFPNGISGRPLPHEEEGTPYSKASSAAEVVQSLMG

Enzyme Prediction     

No EC number prediction in KAF7617384.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE3	56	246	7e-63	0.9948453608247423

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238871	XynB_like	2.41e-43	56	246	1	157	SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB. Most likely a secreted hydrolase with xylanase activity. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
238141	SGNH_hydrolase	1.42e-12	61	245	4	187	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
404371	Lipase_GDSL_2	1.68e-10	61	237	2	176	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
404411	VCBS	7.97e-09	719	780	1	61	Repeat domain in Vibrio, Colwellia, Bradyrhizobium and Shewanella. This domain of about 100 residues is found in multiple (up to 35) copies in long proteins from several species of Vibrio, Colwellia, Bradyrhizobium, and Shewanella (hence the name VCBS) and in smaller copy numbers in proteins from several other bacteria. The large protein size and repeat copy numbers, species distribution, and suggested activities of several member proteins suggests a role for this domain in adhesion (TIGR).
238872	SGNH_hydrolase_like_2	3.62e-08	57	242	3	188	SGNH_hydrolase subfamily. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UDD56943.1|CE0	0.0	1	1415	1	1408
AEO70515.1|CE3	1.11e-206	31	844	84	882
CCT73237.1|CE3|GH43_30	5.21e-206	45	880	69	905
EAA58486.1|CE0	5.36e-196	29	873	32	917
CCT65127.1|CE3	1.39e-187	25	1239	19	1226

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VPT_A	6.86e-15	56	243	6	192	Chain A, LIPOLYTIC ENZYME [Acetivibrio thermocellus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9RLB8|CESA_RUMFL	2.50e-12	56	247	44	261	Multidomain esterase OS=Ruminococcus flavefaciens OX=1265 GN=cesA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000969	0.998996	CS pos: 26-27. Pr: 0.8410

TMHMM  Annotations     

There is no transmembrane helices in KAF7617384.1.