CAZyme Information: KAF7617209.1

Basic Information

• Species: Aspergillus flavus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus flavus
• CAZyme ID: KAF7617209.1
• CAZy Family: AA7
• CAZyme Description: GPI mannosyltransferase 2 [Source:UniProtKB/TrEMBL;Acc:A0A7G5J970]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
472		52007.95	9.9425

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AflavusNRRL3357	14313	332952	0	14313

• Gene Location: location=AAIH03000265:1942914-1944433(+)

Full Sequence      

MSILPDRSYRSLLLIVGSWKALLLLLVVFSPGPAYDTSTALRELGRNAANTDRHGLLTPV
LGLLATNLTRWDAIYFTEIARRGCLFEQEWAFNLGFASLIRAFADVLRRTAGINHALIES
IIGIAVAHAAHGMSVFVLYSLARAVFPGRKGRNLAFIAACLHILSPAGLFLSAPYGESTH
ALLSFMGSLLFVLSFNHAGASTSLRDALIPLSGILYGLATAARSNGLLNGMILLEEAVRL
LYSMTEGVTFAKTRRLIAVGMAGICTGLGFVIPQYIAYKQFCMNNKDPRIWCLRTIPSIY
SFVQDHYWNNGFLRYWTLSNMPLFALAGPMLAIMTYSAIWTLGVGSGGQERGNGKSFSNT
SKTQVHSEAPLTGRLLRSLAAPQIILAILTFLKHHVQIITRMSSGYPMWYLWLAHALVEG
HSLASSEKVDVCRGEKETHILKQYRYARMTIFYMIVYSLVQGVLFASFLPPA

Enzyme Prediction     

No EC number prediction in KAF7617209.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT76	16	472	4.6e-118	0.9877149877149877

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
282094	Mannosyl_trans2	3.71e-43	12	472	4	439	Mannosyltransferase (PIG-V). This is a family of eukaryotic ER membrane proteins that are involved in the synthesis of glycosylphosphatidylinositol (GPI), a glycolipid that anchors many proteins to the eukaryotic cell surface. Proteins in this family are involved in transferring the second mannose in the biosynthetic pathway of GPI.
227829	COG5542	9.97e-15	70	472	76	408	Mannosyltransferase related to Gpi18 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD83592.1|GT76	0.0	1	472	1	472
QMW32162.1|GT76	0.0	1	472	1	472
UDD57107.1|GT76	0.0	1	472	1	472
QMW44188.1|GT76	0.0	1	472	1	472
BAE62404.1|GT76	0.0	1	472	34	523

PDB Hits     

KAF7617209.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2GSI6|GPI18_CHAGB	8.50e-97	7	472	17	471	GPI mannosyltransferase 2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) OX=306901 GN=GPI18 PE=3 SV=1
sp|Q4I0K3|GPI18_GIBZE	1.27e-95	6	472	8	423	GPI mannosyltransferase 2 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI18 PE=3 SV=1
sp|Q2UJS7|GPI18_ASPOR	3.53e-95	5	472	15	434	GPI mannosyltransferase 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=gpi18 PE=3 SV=1
sp|Q4WQ21|GPI18_ASPFU	3.02e-92	5	472	26	441	GPI mannosyltransferase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gpi18 PE=3 SV=1
sp|Q09712|GPI18_SCHPO	1.67e-40	70	472	127	464	GPI mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gpi18 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999983	0.000052

TMHMM  Annotations     

Start	End
12	34
120	142
154	176
181	200
256	278
323	345
450	469