CAZyme Information: KAF7617002.1

Basic Information

• Species: Aspergillus flavus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus flavus
• CAZyme ID: KAF7617002.1
• CAZy Family: AA5
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
463		49199.61	5.0232

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AflavusNRRL3357	14313	332952	0	14313

• Gene Location: location=AAIH03000265:1396349-1397996(+)

Full Sequence      

MEEADYVIVGGGTAALVVACRLSENPETRIVVLERGEDTSSDARVQDPLVYESLMGSEMD
WNLKGAPQSNTAGPIQVSYPVPTERADTTLLDAWKQAFEEHGYGYADELVSEGATIGTRP
YTATIDPVSGHRSSAANGYGAIIASRANVRIVTGASVTRILFDSSAPNGHLTATAVEVQI
EAQGTVLFKPTKEVIMAAGVFNNPQILELSGIGDQARLQTLGISPLVHLPGVGENLTNHA
MSVLSAPVKAHADIQDIAPGMKANAFIHLAPMDMQEILDRAREGPNHAAIAGILNGPNEA
SACIHFSIYPGNLAIIGIFPSFPFSRGSVHIQSADPASSPQIDPKYLNHPSDLDSMVRHV
QHLQEILHSARLQPFVDAPPPQDREALAQLVREAMAIPTAHACGTTAMLPRERGGVVASD
LKVYGVSNVRVVDASVFPVISQANPISTVYTVAERAADLIRAN

Enzyme Prediction     

No EC number prediction in KAF7617002.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	71	462	4.4e-94	0.7341549295774648

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	1.02e-62	1	463	5	536	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	2.00e-62	1	461	3	532	choline dehydrogenase; Validated
398739	GMC_oxred_C	8.45e-37	323	456	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	2.38e-20	5	449	57	565	Protein HOTHEAD
366272	GMC_oxred_N	1.39e-12	130	239	124	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD83786.1|AA3_2	0.0	1	463	1	532
QMW32332.1|AA3_2	0.0	1	463	1	532
QMW44362.1|AA3_2	0.0	1	463	1	532
UDD57301.1|AA3_2	0.0	1	463	1	532
BCS25452.1|AA3_2	5.29e-123	3	461	8	526

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4YNT_A	2.40e-40	5	461	7	565	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
5OC1_A	1.43e-33	3	463	1	564	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
6XUT_A	1.75e-33	2	462	15	589	Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina],6XUU_A Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina],6XUV_A Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina]
3FIM_B	1.69e-32	3	463	2	565	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
6O9N_A	5.08e-32	61	460	185	638	Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus],6O9N_B Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|M5EAX2|GMCH_MALS4	1.54e-49	2	463	45	618	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|Q5GMY3|GMCH_MALSM	1.54e-49	2	463	45	618	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2
sp|A0A5C1RDA6|ASC9_DIDFA	2.99e-43	5	463	15	619	Dehydrogenase OS=Didymella fabae OX=372025 GN=orf9 PE=3 SV=1
sp|A0A2H3D1U1|ARMD5_ARMGA	4.83e-43	5	461	41	630	Dehydrogenase ARMGADRAFT_1018426 OS=Armillaria gallica OX=47427 GN=ARMGADRAFT_1018426 PE=1 SV=1
sp|A0A161CEV4|CITC_MONRU	1.08e-36	5	461	15	609	Dehydrogenase citC OS=Monascus ruber OX=89489 GN=citC PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000030	0.000001

TMHMM  Annotations     

There is no transmembrane helices in KAF7617002.1.