CAZyme Information: KAF7616976.1

Basic Information

• Species: Aspergillus flavus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus flavus
• CAZyme ID: KAF7616976.1
• CAZy Family: PL7
• CAZyme Description: Apple domain-containing protein [Source:UniProtKB/TrEMBL;Acc:B8NDN6]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
477	AAIH03000265|CGC12	54665.99	6.2541

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AflavusNRRL3357	14313	332952	0	14313

• Gene Location: location=AAIH03000265:1330048-1331540(-)

Full Sequence      

MARIILSRKTTNLLVFILFVVIVASVFKISVPDTSLDPATLYHHATGHDKNEPDYWEWET
TTRFAPIKNQFTASSSADDDHLCDSFPTYVLSRIQVVLKIGASEPADRVDAQISTVTRCI
PNLLIVSDRESELKGHRVHDILATLPESFRFNVTDLEPYEALRRGDEKAVGSDEGWYLDR
FKFLPMVERAHETNPTAQWYVFLESDTYYVWDNLFRLLDQYDPSEPLYLGSPSPGREISQ
GKPMYFAYGGAGFVLSGGAMKKMVHRHHGSMGEYIEPSLSLQYEDIVKGDCCGDSVLGWV
LYQKGVKLSGLWPMFNPHPLHSIPFDNAYWCQPVISMHKTMLSDMKGLNEWENQRDRKKP
LLYADLFEYTRMGTFESKPDWDNGDWGGFREPDESPAHMSMEACRTACHEHAECLSYTYD
HSGHCILVRTMRLGHSKPPTNEVRLSAGWDVSKMRNWRASHQCEKPMWVKPSITRIF

Enzyme Prediction     

No EC number prediction in KAF7616976.1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
367085	Fringe	3.57e-08	199	318	87	204	Fringe-like. The drosophila protein fringe (FNG) is a glucosaminyltransferase that controls the response of the Notch receptor to specific ligands. FNG is localized to the Golgi apparatus (not secreted as previously thought). Modification of Notch occurs through glycosylation by FNG. The xenopus homolog, lunatic fringe, has been implicated in a variety of functions.
215605	PLN03153	3.25e-06	195	256	209	270	hypothetical protein; Provisional
394981	PAN_1	0.002	400	427	24	52	PAN domain. The PAN domain contains a conserved core of three disulphide bridges. In some members of the family there is an additional fourth disulphide bridge the links the N and C termini of the domain. The domain is found in diverse proteins, in some they mediate protein-protein interactions, in others they mediate protein-carbohydrate interactions.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD83812.1|GT31	0.0	1	477	1	477
QMW32351.1|GT31	0.0	1	477	1	477
UDD57328.1|GT31	0.0	1	477	1	477
BAE62206.1|GT31	0.0	1	477	1	477
QMW44383.1|GT31	0.0	1	477	1	477

PDB Hits     

KAF7616976.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9NS00|C1GLT_HUMAN	4.44e-06	166	264	128	224	Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 OS=Homo sapiens OX=9606 GN=C1GALT1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999790	0.000223

TMHMM  Annotations     

Start	End
13	32