CAZyme Information: KAF7616280.1

Basic Information

• Species: Aspergillus flavus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus flavus
• CAZyme ID: KAF7616280.1
• CAZy Family: AA3
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
380		38895.94	4.3902

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AflavusNRRL3357	14313	332952	0	14313

• Gene Location: location=AAIH03000282:1695971-1697642(+)

Full Sequence      

MPIKSFASRLALSLAICGTAMGQKVNGADYNKPDGGPPAKFFQASSSIPVAAIQAAAAKA
SKVPSHATYPIGQGSTKSTIHSDWAGFSEGAAFSFIADMDVDCDGLNHGCKGNPDGQKET
NWGALSAYEVPFIVIPQEFLDANKGTLKGNAVAAVICNGKMFYGIFGDSNGDSPQVTGEA
SWLMARTCFPEEDLNGNKGHTAADVTYIVFTGDKAVLPSSALNKNYITNFDTLRSMGDSL
VGALAKNLNLGGGGGNPPTTLTTTSIPEPTGGSGSCSWPGHCAGATCSSNDDCSDDLACQ
NGKCASDGSAETCSWEGHCKGATCSSNDDCSDELACISGICSVDNGVETCEWEGHCEGAS
CSSHDDCDGSLACKNGKCSA

Enzyme Prediction     

EC	3.2.1.132:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH75	47	242	2.7e-79	0.990909090909091

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
399960	Glyco_hydro_75	9.76e-59	99	243	1	165	Fungal chitosanase of glycosyl hydrolase group 75. This family consists of several fungal chitosanase proteins. Chitin, xylan, 6-O-sulphated chitosan and O-carboxymethyl chitin are indigestible by chitosanase. EC:3.2.1.132. The mechanism is likely to be inverting, and the probable catalytic neutrophile base is Asp, with the probable catalytic proton donor being Glu. (see the Chitosanase web-page from CAZY).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UDD61138.1|GH75	5.60e-218	1	312	1	312
QRD84969.1|GH75	4.61e-217	1	312	1	312
UDD61137.1|GH75	4.61e-217	1	312	1	312
BAD08218.2|GH75|3.2.1.132	4.39e-215	1	311	1	311
BAE63124.1|GH75	3.36e-212	1	312	1	321

PDB Hits     

KAF7616280.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q75R32|CSNC_ASPOZ	7.80e-216	1	311	1	311	Endo-chitosanase C OS=Aspergillus oryzae OX=5062 GN=csnC PE=1 SV=2
sp|Q2U5P1|CSNC_ASPOR	5.96e-213	1	312	1	321	Endo-chitosanase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=csnC PE=3 SV=1
sp|Q2U3M5|CSN_ASPOR	2.22e-26	97	244	77	243	Endo-chitosanase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=csn PE=3 SV=1
sp|Q9P961|CSN_ASPOZ	2.22e-26	97	244	77	243	Endo-chitosanase OS=Aspergillus oryzae OX=5062 GN=csn PE=1 SV=1
sp|Q8NK76|CSNB_ASPOZ	9.96e-25	81	244	48	238	Endo-chitosanase B OS=Aspergillus oryzae OX=5062 GN=csnB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.006777	0.993199	CS pos: 22-23. Pr: 0.6845

TMHMM  Annotations     

There is no transmembrane helices in KAF7616280.1.