CAZyme Information: KAF7616032.1

Basic Information

• Species: Aspergillus flavus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus flavus
• CAZyme ID: KAF7616032.1
• CAZy Family: AA2
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
413		46648.64	9.9434

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AflavusNRRL3357	14313	332952	0	14313

• Gene Location: location=AAIH03000282:1068810-1070173(-)

Full Sequence      

MELKHFIHELCLNPRHTKWIAPLLVIGDAFLCALIIWKIPYTEIDWTTYMQQIALYISGE
RDYTLIKGSTGPLVYPAAHVYSYMALYHLTDEGRDILFGQILFAVLYLVTLAVVMVCYRQ
SGAPPYLFPLLVLSKRLHSVFVLRLFNDGLAVCAMWIAILLFQNKKWTAGVTAWTVGVGI
KMTLLLLAPAIAVVTVLSLSLVPSIRLGILALLIQVLLAIPFLQGNPIGYVARAFELTRQ
FMFKWTVNWRFVGEDLFLSKQFSLALLGLHIFLLGLFVTTGWLRPSGSNVPDFLRSLLQG
RQRTVVLSKSFIMTVMLTSLAIGLLCARSLHYQFFAYLSWATPCLLWRARLHPILIYAIW
ALQEWAWNVYPSTNASSSVVVFSLAVQVFGVLLNSRNALSDAPPRRKGKEHIQ

Enzyme Prediction     

EC	2.4.1.258:10

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT58	21	377	8.5e-148	0.9972527472527473

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398745	ALG3	0.0	22	377	1	358	ALG3 protein. The formation of N-glycosidic linkages of glycoproteins involves the ordered assembly of the common Glc3Man9GlcNAc2 core-oligosaccharide on the lipid carrier dolichyl pyrophosphate. Whereas early mannosylation steps occur on the cytoplasmic side of the endoplasmic reticulum with GDP-Man as donor, the final reactions from Man5GlcNAc2-PP-Dol to Man9GlcNAc2-PP-Dol on the lumenal side use Dol-P-Man. ALG3 gene encodes the Dol-P-Man:Man5GlcNAc2-PP-Dol mannosyltransferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAE62911.1|GT58	5.27e-297	1	413	1	413
UDD58266.1|GT58	5.27e-297	1	413	1	413
QMW45188.1|GT58	9.99e-295	1	413	141	553
QMW33155.1|GT58	9.99e-295	1	413	141	553
QRD84733.1|GT58	1.40e-260	42	413	118	489

PDB Hits     

KAF7616032.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2U6A4|ALG3_ASPOR	9.36e-298	1	413	1	413	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=alg3 PE=3 SV=1
sp|Q4WVG2|ALG3_ASPFU	3.73e-218	1	413	9	419	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=alg3 PE=3 SV=1
sp|A1DDZ3|ALG3_NEOFI	9.23e-210	1	413	1	411	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=alg3 PE=3 SV=1
sp|A1CBE6|ALG3_ASPCL	4.12e-209	1	413	63	472	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=alg3 PE=3 SV=1
sp|A2RA94|ALG3_ASPNC	9.88e-202	1	413	1	409	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=alg3 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000022	0.000001

TMHMM  Annotations     

Start	End
183	205
209	231
262	284
304	326
20	42
96	118
140	162