CAZyme Information: KAF7615697.1

Basic Information

• Species: Aspergillus flavus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus flavus
• CAZyme ID: KAF7615697.1
• CAZy Family: AA1
• CAZyme Description: Rhamnogalacturonase A [Source:UniProtKB/TrEMBL;Acc:A0A7G5JB95]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
449	AAIH03000282|CGC8	47919.86	4.0783

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AflavusNRRL3357	14313	332952	0	14313

• Gene Location: location=AAIH03000282:229501-231036(+)

Full Sequence      

MRSKTFSVLSSCLLLIATVQGQLSGSVGPSTSISDKKAVKTCNVLDYGATNDNKTDVGQP
IMDAFEDCGSGGVIYIPDGDYLIQEWVSLENGTAFAIQLDGVIYRNGTTTSQGYMFGISG
GSDFELYSSTSKGAIQGSGYLYHMNGEFTAPRLLHISDVSHWSVHDIALVDAPMFHFVID
DASNGEVYNMAIRGGNSGGLDGIDVSGDNIWIHDVMVTNKDECVTVKTGSHNFQIENIYC
NWSGGCAMGSLGSGTNVSNIVYRNIYTWNSNQMYMIKSNGGDGEVSNLLFENFIGHGNAY
SLDLDSEWSSMDTVDGDGIFYRNITFKNWKGTETDGESRPSIRVICPEATPCTDITIEDV
DLWTEEGDSETYVCKNAFGSGACLKSDSSSTATYATTTTVTSAPSGYSATTMAADLTSAF
GTDASIPIPTIPTSFYPGATPYSALAGSS

Enzyme Prediction     

EC	3.2.1.171:11

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	68	377	1.2e-56	0.9538461538461539

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
215540	PLN03010	2.12e-22	43	379	48	391	polygalacturonase
395231	Glyco_hydro_28	1.52e-19	149	383	83	321	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
177865	PLN02218	7.07e-18	37	377	63	418	polygalacturonase ADPG
215120	PLN02188	1.78e-16	13	377	9	390	polygalacturonase/glycoside hydrolase family protein
215426	PLN02793	5.05e-16	5	380	14	412	Probable polygalacturonase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD84419.1|GH28	0.0	1	449	6	454
QMW32887.1|GH28	0.0	1	449	1	449
UDD57956.1|GH28	0.0	1	449	6	454
QMW44915.1|GH28	0.0	1	449	1	449
BAE62561.1|GH28	1.03e-308	1	449	1	432

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1RMG_A	2.63e-210	22	447	1	422	Rhamnogalacturonase A From Aspergillus Aculeatus [Aspergillus aculeatus]
1K5C_A	1.70e-07	201	263	153	214	Endopolygalacturonase I from Stereum purpureum at 0.96 A resolution [Chondrostereum purpureum],1KCC_A Endopolygalacturonase I from Stereum purpureum complexed with a galacturonate at 1.00 A resolution. [Chondrostereum purpureum],1KCD_A Endopolygalacturonase I from Stereum purpureum complexed with two galacturonate at 1.15 A resolution. [Chondrostereum purpureum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B8NKB9|RHGE_ASPFN	0.0	1	449	1	449	Probable rhamnogalacturonase E OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=rhgE PE=3 SV=2
sp|Q2U7A4|RHGE_ASPOR	1.83e-309	1	449	1	432	Probable rhamnogalacturonase E OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=rhgE PE=3 SV=1
sp|Q1ZZM3|RHGE_ASPNG	9.54e-238	15	449	16	450	Probable rhamnogalacturonase E OS=Aspergillus niger OX=5061 GN=rhgE PE=3 SV=1
sp|Q00001|RHGA_ASPAC	3.88e-211	17	447	14	440	Rhamnogalacturonase A OS=Aspergillus aculeatus OX=5053 GN=rhgA PE=1 SV=1
sp|Q5ARE6|RHGA_EMENI	6.97e-209	10	449	4	442	Rhamnogalacturonase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=rhgA PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000230	0.999721	CS pos: 21-22. Pr: 0.9798

TMHMM  Annotations     

There is no transmembrane helices in KAF7615697.1.