CAZyme Information: KAF6530421.1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: KAF6530421.1
• CAZy Family: PL1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
447	CM024360|CGC5	51151.41	7.5196

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FoxysporumFo5176	17912	660025	0	17912

• Gene Location: location=CM024360:5976544-5978758(+)

Full Sequence      

MLLMKASNYGKLNSYRWLYNGFARVLDHNMTVNLDVGTKLGKQALFKLWKEFDLEPMLAA
ACGEISCSLGGSWLNLLNPSVTAQNFEYKVGFQLDRTFESATGFLSLLPGACSAYRYVGS
SGKPLEDMLLGDPTWIQGHNRDRPALSPVNINRHLADDRVICFRIISKPNTQWLLKYVPV
TATTDIPITTTDFINQRRRWLNGAFFSTIYVLKRCGHLWRGPVPWRVAILLEELNIPYAS
KYLESDELNSEAFKSINPNAKTPAIEDPNTGIKLFEAGAIILYLLDTYDTSGSIHSFSGP
QKYLELAWMQFQATEQHMYYSQQAWFLYKHPEHVQSALKRYEWTIKRTIGMLEEHLKQTG
KTYLTGDEITFADLCFVVTNELIPQLLPGYDPSKDFPHYARWNSALVNRPSYQKIAADRA
ALGQPLGQVDQKHIDDHIWRNDPDHKW

Enzyme Prediction     

No EC number prediction in KAF6530421.1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133033	Chitin_synth_C	3.33e-40	8	206	51	243	C-terminal domain of Chitin Synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin. Chitin synthase, also called UDP-N-acetyl-D-glucosamine:chitin 4-beta-N-acetylglucosaminyltransferase, catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of GlcNAc residues formed by covalent beta-1,4 linkages. Chitin is an important component of the cell wall of fungi and bacteria and it is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases. Studies with fungi have revealed that most of them contain more than one chitin synthase gene. At least five subclasses of chitin synthases have been identified.
198326	GST_C_Ure2p	1.08e-28	301	414	1	116	C-terminal, alpha helical domain of fungal Ure2p Glutathione S-transferases. Glutathione S-transferase (GST) C-terminal domain family, Ure2p subfamily; composed of the Saccharomyces cerevisiae Ure2p and related fungal proteins. Ure2p is a regulator for nitrogen catabolism in yeast. It represses the expression of several gene products involved in the use of poor nitrogen sources when rich sources are available. A transmissible conformational change of Ure2p results in a prion called [Ure3], an inactive, self-propagating and infectious amyloid. Ure2p displays a GST fold containing an N-terminal thioredoxin-fold domain and a C-terminal alpha helical domain. The N-terminal thioredoxin-fold domain is sufficient to induce the [Ure3] phenotype and is also called the prion domain of Ure2p. In addition to its role in nitrogen regulation, Ure2p confers protection to cells against heavy metal ion and oxidant toxicity, and shows glutathione (GSH) peroxidase activity. GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of GSH with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress. GSTs also show GSH peroxidase activity and are involved in the synthesis of prostaglandins and leukotrienes. The GST active site is located in a cleft between the N- and C-terminal domains. GSH binds to the N-terminal domain while the hydrophobic substrate occupies a pocket in the C-terminal domain.
223698	GstA	1.51e-28	217	423	5	209	Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones].
239346	GST_N_Ure2p_like	7.50e-24	217	290	5	81	GST_N family, Ure2p-like subfamily; composed of the Saccharomyces cerevisiae Ure2p and related GSTs. Ure2p is a regulator for nitrogen catabolism in yeast. It represses the expression of several gene products involved in the use of poor nitrogen sources when rich sources are available. A transmissible conformational change of Ure2p results in a prion called [Ure3], an inactive, self-propagating and infectious amyloid. Ure2p displays a GST fold containing an N-terminal TRX-fold domain and a C-terminal alpha helical domain, with an active site located in a cleft between the two domains. The N-terminal TRX-fold domain is sufficient to induce the [Ure3] phenotype and is also called the prion domain of Ure2p. In addition to its role in nitrogen regulation, Ure2p confers protection to cells against heavy metal ion and oxidant toxicity, and shows glutathione (GSH) peroxidase activity. Characterized GSTs in this subfamily include Aspergillus fumigatus GSTs 1 and 2, and Schizosaccharomyces pombe GST-I. GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of GSH with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress. GSTs also show GSH peroxidase activity and are involved in the synthesis of prostaglandins and leukotrienes.
396286	Chitin_synth_1	6.05e-19	1	52	112	163	Chitin synthase. This region is found commonly in chitin synthases classes I, II and III. Chitin a linear homopolymer of GlcNAc residues, it is an important component of the cell wall of fungi and is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD46535.1|GT2	1.25e-149	4	229	1	231
CCT63250.1|GT2	3.62e-144	1	220	214	433
UPK95347.1|GT2	1.28e-78	1	220	245	461
AGN03155.1|GT2	5.61e-58	1	220	23	240
AGN03156.1|GT2	1.34e-57	1	220	24	241

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZB6_A	2.69e-36	221	420	16	218	Chain A, PcUre2p4 [Phanerodontia chrysosporium],4ZB6_B Chain B, PcUre2p4 [Phanerodontia chrysosporium],4ZB6_C Chain C, PcUre2p4 [Phanerodontia chrysosporium],4ZB6_D Chain D, PcUre2p4 [Phanerodontia chrysosporium]
4ZB7_A	5.13e-35	221	422	15	219	Chain A, PcUre2p6 [Phanerodontia chrysosporium],4ZB7_B Chain B, PcUre2p6 [Phanerodontia chrysosporium],4ZB7_C Chain C, PcUre2p6 [Phanerodontia chrysosporium],4ZB7_D Chain D, PcUre2p6 [Phanerodontia chrysosporium],4ZB8_A Chain A, PcUre2p6 [Phanerodontia chrysosporium],4ZBD_A Chain A, PcUre2p6 [Phanerodontia chrysosporium],4ZBD_B Chain B, PcUre2p6 [Phanerodontia chrysosporium]
4ZB9_A	7.31e-32	225	422	20	219	Chain A, PcUre2p8 [Phanerodontia chrysosporium],4ZB9_B Chain B, PcUre2p8 [Phanerodontia chrysosporium],4ZB9_C Chain C, PcUre2p8 [Phanerodontia chrysosporium],4ZB9_D Chain D, PcUre2p8 [Phanerodontia chrysosporium],4ZBA_A Chain A, PcUre2p8 [Phanerodontia chrysosporium],4ZBA_B Chain B, PcUre2p8 [Phanerodontia chrysosporium],4ZBA_C Chain C, PcUre2p8 [Phanerodontia chrysosporium],4ZBA_D Chain D, PcUre2p8 [Phanerodontia chrysosporium],4ZBB_A Chain A, PcUre2p8 [Phanerodontia chrysosporium],4ZBB_B Chain B, PcUre2p8 [Phanerodontia chrysosporium],4ZBB_C Chain C, PcUre2p8 [Phanerodontia chrysosporium],4ZBB_D Chain D, PcUre2p8 [Phanerodontia chrysosporium]
4IVF_A	1.14e-17	218	414	10	216	Chain A, Crystal structure of glutathione transferase homolog from Lodderomyces elongisporus, target EFI-501753, with two GSH per subunit [Lodderomyces elongisporus NRRL YB-4239],4IVF_B Chain B, Crystal structure of glutathione transferase homolog from Lodderomyces elongisporus, target EFI-501753, with two GSH per subunit [Lodderomyces elongisporus NRRL YB-4239],4IVF_C Chain C, Crystal structure of glutathione transferase homolog from Lodderomyces elongisporus, target EFI-501753, with two GSH per subunit [Lodderomyces elongisporus NRRL YB-4239],4IVF_D Chain D, Crystal structure of glutathione transferase homolog from Lodderomyces elongisporus, target EFI-501753, with two GSH per subunit [Lodderomyces elongisporus NRRL YB-4239],4IVF_E Chain E, Crystal structure of glutathione transferase homolog from Lodderomyces elongisporus, target EFI-501753, with two GSH per subunit [Lodderomyces elongisporus NRRL YB-4239],4IVF_F Chain F, Crystal structure of glutathione transferase homolog from Lodderomyces elongisporus, target EFI-501753, with two GSH per subunit [Lodderomyces elongisporus NRRL YB-4239],4IVF_G Chain G, Crystal structure of glutathione transferase homolog from Lodderomyces elongisporus, target EFI-501753, with two GSH per subunit [Lodderomyces elongisporus NRRL YB-4239],4IVF_H Chain H, Crystal structure of glutathione transferase homolog from Lodderomyces elongisporus, target EFI-501753, with two GSH per subunit [Lodderomyces elongisporus NRRL YB-4239]
1JZR_A	5.43e-16	222	414	29	255	Ure2p in complex with glutathione [Saccharomyces cerevisiae],1JZR_B Ure2p in complex with glutathione [Saccharomyces cerevisiae],1JZR_C Ure2p in complex with glutathione [Saccharomyces cerevisiae],1JZR_D Ure2p in complex with glutathione [Saccharomyces cerevisiae],1K0A_A Ure2p in Complex with S-hexylglutathione [Saccharomyces cerevisiae],1K0A_B Ure2p in Complex with S-hexylglutathione [Saccharomyces cerevisiae],1K0B_A Ure2p in Complex with Glutathione [Saccharomyces cerevisiae],1K0B_B Ure2p in Complex with Glutathione [Saccharomyces cerevisiae],1K0B_C Ure2p in Complex with Glutathione [Saccharomyces cerevisiae],1K0B_D Ure2p in Complex with Glutathione [Saccharomyces cerevisiae],1K0C_A Ure2p in complex with S-p-nitrobenzylglutathione [Saccharomyces cerevisiae],1K0C_B Ure2p in complex with S-p-nitrobenzylglutathione [Saccharomyces cerevisiae],1K0C_C Ure2p in complex with S-p-nitrobenzylglutathione [Saccharomyces cerevisiae],1K0C_D Ure2p in complex with S-p-nitrobenzylglutathione [Saccharomyces cerevisiae],1K0D_A Ure2p in Complex with Glutathione [Saccharomyces cerevisiae],1K0D_B Ure2p in Complex with Glutathione [Saccharomyces cerevisiae],1K0D_C Ure2p in Complex with Glutathione [Saccharomyces cerevisiae],1K0D_D Ure2p in Complex with Glutathione [Saccharomyces cerevisiae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P30588|CHS3_NEUCR	7.05e-56	1	239	334	577	Chitin synthase 3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=chs-3 PE=3 SV=2
sp|P23316|CHS1_CANAX	6.64e-55	1	219	205	430	Chitin synthase 1 OS=Candida albicans OX=5476 GN=CHS1 PE=2 SV=2
sp|Q12564|CHSA_AMPQU	1.87e-54	1	220	350	567	Chitin synthase A OS=Ampelomyces quisqualis OX=50730 GN=CHSA PE=3 SV=1
sp|P30583|CHSC_EMENI	4.99e-54	4	220	368	582	Chitin synthase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=chsC PE=3 SV=3
sp|P54267|CHSG_ASPFU	1.23e-53	1	220	339	560	Chitin synthase G OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=chsG PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000065	0.000000

TMHMM  Annotations     

There is no transmembrane helices in KAF6530421.1.