CAZyme Information: KAF6526799.1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: KAF6526799.1
• CAZy Family: GT1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
327		39442.73	8.0639

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FoxysporumFo5176	17912	660025	0	17912

• Gene Location: location=CM024362:3092464-3093552(-)

Full Sequence      

MLCYTIFYTTPLVYYWRRSFGGGNKFVIILGANVGGGVMEWKGAREWAIERDSVRNKRKY
VNRWGYDLEIVDMSTKKKYAHEWRESWEKVDFIRSTLRKYPKAEWVWWLDLNTFVMEPSV
SLQDHIFNHLQTEVERDINYFNPRNISHPFTHHYLDEVSRSPVGDGKANSINMIMTQDCA
GFNLGSFFMRRSDWTDRLLDVWWDPVTYEQKHMQWEHKEQDALDQLYQSQPWVRKHVGFL
HQRKINSFPPGACNPDGGPKDKHIHYEENQRDFLVNMAGCEWGRDCWGEMYYYREFSYWL
NRNPWERFKEDLIAVIWFKLTGKKVKL

Enzyme Prediction     

No EC number prediction in KAF6526799.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT34	24	288	1.1e-81	0.9878048780487805

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
368535	Glyco_transf_34	1.07e-75	24	286	3	238	galactosyl transferase GMA12/MNN10 family. This family contains a number of glycosyltransferase enzymes that contain a DXD motif. This family includes a number of C. elegans homologs where the DXD is replaced by DXH. Some members of this family are included in glycosyltransferase family 34.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD51240.1|GT34	1.08e-253	1	327	126	452
QGI93066.1|GT34	3.61e-252	1	327	126	452
QGI62170.1|GT34	3.61e-252	1	327	126	452
QGI79340.1|GT34	3.61e-252	1	327	126	452
CCT65988.1|GT34	3.61e-252	1	327	126	452

PDB Hits     

KAF6526799.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P50108|MNN10_YEAST	1.05e-103	25	308	121	390	Probable alpha-1,6-mannosyltransferase MNN10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNN10 PE=1 SV=1
sp|P78817|YFE6_SCHPO	1.35e-79	24	294	73	331	Uncharacterized alpha-1,2-galactosyltransferase C637.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC637.06 PE=2 SV=2
sp|O94622|YBKD_SCHPO	2.79e-30	51	280	125	333	Uncharacterized alpha-1,2-galactosyltransferase C1289.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1289.13c PE=3 SV=1
sp|Q09174|GMA12_SCHPO	7.07e-28	24	286	102	339	Alpha-1,2-galactosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gma12 PE=1 SV=1
sp|Q10359|GMH3_SCHPO	3.93e-22	54	280	112	314	Alpha-1,2-galactosyltransferase gmh3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gmh3 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999554	0.000469

TMHMM  Annotations     

There is no transmembrane helices in KAF6526799.1.