CAZyme Information: KAF6526052.1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: KAF6526052.1
• CAZy Family: GH76
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
750		82782.79	6.8036

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FoxysporumFo5176	17912	660025	0	17912

• Gene Location: location=CM024362:480602-482854(+)

Full Sequence      

MEESLNFHRAVKQLQGGKDAPRLAQTLLQQLTQDEKLGLLHGDPPFWKGFSHLFGGEYTK
RPYSHGKLERLGIPGVQYCDGPRGVNINQATVFPCSTARGATWDTALEESVARAISREAR
VYGANCVGSVCVNLPRHPAWGRVQETYGEDPLLLGEFGAAHVRGLQENVMACVKHFALNS
METARFRVNVSIDACALHEVYLPHFKQCIDAGALSIMTAYNSINGEWAGESVALIRNILR
ERWSFSGIAITDWLFGLRDGVKSVKADLDIECPFQNRRQTSLRPALESGEISWSDIDRIA
SRIIQTQLTFYANRQSVEPERAVVFGREHRELARTVGSRAIVLLKNGLINEQPLLPLSQS
IKTCAIVGRHADSALTGDRASSWVHCPEVISPYQGLKEQLPHTSITLSASRDIRAAVEAA
KKSEMAIVMVGYDGDDEGEFLKPSWENDGKALALLPQPDGSLEAQRVVEGRAKAADASNR
PQAGTGARPEDDLASRPVGGDRRSVRLAPEDVELIRAVVKTNPRTIVSIITAGAVIIEEW
HDIVPSILINWYNGCENGRALADVLAGRSNPSGHLPWSMPRTEVHLPSFDPDANQVTYDK
WFGQRMLDKMGVKAAYPLGFGLSYTTFEVECIDFDTSSLDETLSLQVGARVRNTGSRLGH
CVVQIYGCPDLGPGQHDFPNRLLAGFQVVELSGQETKWVQVKTSLAPFRRWEEGDLRLTA
RSILFQVGQYAGDQKSLSYRFHLRGAEARL

Enzyme Prediction     

No EC number prediction in KAF6526052.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	69	273	6.7e-60	0.9768518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	5.06e-63	68	700	99	722	beta-glucosidase BglX.
224389	BglX	2.24e-61	70	399	57	386	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
178629	PLN03080	2.31e-47	21	689	50	728	Probable beta-xylosidase; Provisional
396478	Glyco_hydro_3_C	3.14e-44	341	624	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
395747	Glyco_hydro_3	3.86e-38	67	304	60	314	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD52038.1|GH3	0.0	1	750	1	750
UPL03152.1|GH3	0.0	1	737	1	734
UPL03376.1|GH3	0.0	6	737	9	739
UQU67868.1|GH3	1.46e-242	7	738	6	722
QKD58937.1|GH3	2.98e-242	3	734	22	742

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2X40_A	4.25e-77	27	666	7	638	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	5.80e-76	27	666	7	638	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]
7MS2_A	9.97e-67	27	699	8	623	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
3AC0_A	4.38e-62	25	733	7	827	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	3.00e-59	25	733	7	827	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P14002|BGLB_ACET2	5.13e-66	27	699	8	623	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
sp|A7LXS8|BGH3A_BACO1	3.07e-65	57	707	57	706	Beta-glucosidase BoGH3A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02644 PE=1 SV=1
sp|Q5BFG8|BGLB_EMENI	2.06e-63	21	733	8	829	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1
sp|Q5BA18|BGLK_EMENI	9.91e-61	68	745	40	825	Probable beta-glucosidase K OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglK PE=2 SV=1
sp|B8NPL7|BGLH_ASPFN	5.02e-59	27	713	8	787	Probable beta-glucosidase H OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglH PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000068	0.000000

TMHMM  Annotations     

There is no transmembrane helices in KAF6526052.1.