CAZyme Information: KAF6525182.1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: KAF6525182.1
• CAZy Family: GH7
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
934		104660.95	5.2077

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FoxysporumFo5176	17912	660025	0	17912

• Gene Location: location=CM024363:1495828-1499488(+)

Full Sequence      

MSSIDKPLSESQASRPGDFEAIRKSIIDLLRQPDYDDGSAGPVLVRLAWHSSGTYDVETD
TGGSNGAGMRYEAEGGDPANAGLQNARLFLEPVKRLHPWITYSDLWTLAGVTAIRAMGGP
EIDWVPGRTDFVDDSKLPPRGRLPDAAQGADHIRDIFYRMGFNDREIVALSGAHSLGRCH
TENSGFEGKWVNNPTRFSNQYFRLLLSEKWTEKTVPESGVTQFSSVDPDTEEELMMLPTD
MALTTDPEFSKYVQMRPMDLAKELDAAVPTMNDMLDFLPIPTLVVSPSYRIHRASAGLLE
AWGRRREVLVGQDLFTALYHGSPTERFDRIPFVYAIETALEARALRLCHAAYVANGISWT
ARIMPVHNGDELLCLVIEWEQDELHTTTLNGEITQSWLPIDDAFRILVQAVKDYAIFLLD
TRGNVMTWNTGAELNKGYKKEEIIGKHFTTFYGEEDIRSRKPERELEICLREGRVEDEGW
RYRKDGSRFWANVVITAIYKNDIHVGFGKVTRNLTERKEAELRLTAAYEESTKLKNDFLA
NMSHEIRTPMHGVLSACSLLLDSRLTEEQRETANMIQESGQVLLRIINDILDYSKIAAGT
FPVENERLDIANVITSAVRRVQTTVQPGVSLKLNLSPNLPKWAEGDALRYRQIFENLLSN
AVKFTERGYISVNASMLTEDETSHTIETEVWDTGHGVTEADAQELFKPFTQLDTPHQKRR
PGTGLGLSIAKSLVELLGGSIGYKPNPERQGSIFWFSFKVKRLSSLRQAESIIAPPGGSS
ELPHQELQGGEDLATQLEQLLKISPTKRILAAEDNIINQKVLVGMLHGFGFKDITVVSDG
AQAVSSLSAASNAFDLILMDISMPIMNGYEATLRIRRSSIRLPIIAMTAYALKGDMERCL
EKGMDDYIPKPMDKQVLMRKLLKWLQSPGDVIQT

Enzyme Prediction     

No EC number prediction in KAF6525182.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA2	35	255	1.6e-49	0.8392156862745098

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
173825	ascorbate_peroxidase	2.40e-119	11	255	5	226	Ascorbate peroxidases and cytochrome C peroxidases. Ascorbate peroxidases are a subgroup of heme-dependent peroxidases of the plant superfamily that share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Along with related catalase-peroxidases, ascorbate peroxidases belong to class I of the plant superfamily. Ascorbate peroxidases are found in the chloroplasts and/or cytosol of algae and plants, where they have been shown to control the concentration of lethal hydrogen peroxide molecules. The yeast cytochrome c peroxidase is a divergent member of the family; it forms a complex with cytochrome c to catalyze the reduction of hydrogen peroxide to water.
274362	TMAO_torS	1.13e-81	496	927	400	823	TMAO reductase sytem sensor TorS. This protein, TorS, is part of a regulatory system for the torCAD operon that encodes the pterin molybdenum cofactor-containing enzyme trimethylamine-N-oxide (TMAO) reductase (TorA), a cognate chaperone (TorD), and a penta-haem cytochrome (TorC). TorS works together with the inducer-binding protein TorT and the response regulator TorR. TorS contains histidine kinase ATPase (pfam02518), HAMP (pfam00672), phosphoacceptor (pfam00512), and phosphotransfer (pfam01627) domains and a response regulator receiver domain (pfam00072). [Signal transduction, Two-component systems]
178218	PLN02608	7.05e-75	39	266	29	227	L-ascorbate peroxidase
236848	PRK11107	2.40e-74	530	928	288	788	hybrid sensory histidine kinase BarA; Provisional
237951	PRK15347	2.09e-66	511	921	381	806	two component system sensor kinase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD61761.1|AA2	1.63e-178	1	264	1	262
QGI94677.1|AA2	4.64e-175	1	264	1	262
QGI63795.1|AA2	4.64e-175	1	264	1	262
QGI81067.1|AA2	5.22e-174	1	264	1	262
QPC69144.1|AA2	4.58e-160	1	259	1	259

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1JCI_A	1.73e-62	18	254	18	249	Chain A, Cytochrome C Peroxidase [Saccharomyces cerevisiae]
1JDR_A	3.08e-61	18	254	18	249	Chain A, Cytochrome c Peroxidase [Saccharomyces cerevisiae]
1STQ_A	8.05e-61	18	254	18	249	Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae]
4NFG_A	2.10e-60	18	254	18	249	K13R mutant of horse cytochrome c and yeast cytochrome c peroxidase complex [Saccharomyces cerevisiae]
1S6V_A	2.10e-60	18	254	18	249	Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],1S6V_C Chain C, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],2N18_A Dominant form of the low-affinity complex of yeast cytochrome c and cytochrome c peroxidase [Saccharomyces cerevisiae S288C]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9P896|TCSA_EMENI	1.18e-181	267	924	41	679	Two-component system protein A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=tcsA PE=3 SV=2
sp|Q4HWQ2|CCPR2_GIBZE	1.15e-160	1	259	1	259	Putative heme-binding peroxidase OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=FGRRES_10606 PE=3 SV=1
sp|A4R606|CCPR2_MAGO7	7.05e-135	13	254	2	243	Putative heme-binding peroxidase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) OX=242507 GN=MGG_10368 PE=3 SV=1
sp|Q4WLG9|CCPR2_ASPFU	2.64e-124	14	253	2	243	Putative heme-binding peroxidase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=AFUA_6G13570 PE=3 SV=1
sp|Q5B1Z0|CCPR2_EMENI	7.29e-124	14	254	2	244	Putative heme-binding peroxidase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=AN5440 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000085	0.000000

TMHMM  Annotations     

There is no transmembrane helices in KAF6525182.1.