CAZyme Information: KAF6525039.1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: KAF6525039.1
• CAZy Family: GH64
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
658		71224.63	5.0767

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FoxysporumFo5176	17912	660025	0	17912

• Gene Location: location=CM024363:1122089-1124116(+)

Full Sequence      

MRCNVLSPSLLALSLSTSVTARPEIPFISTLLDPLQHIVKSAYAGDGLKVGHLGELGGIP
GVDAEYDYVVVGGGTAGNTIGYRLAKAGYSVAIVEAGPFLEISKPILATSPGGVTAGSGA
SLLDSNPLRDWRFTTTAQTGADDREIHYARGKVLGGSSQLNFLVYHRPTNGTMAKWAEDV
GDDSYTWEQMLPHFQKSPSFTPPDNEKRNVTTDYDASAFSKEKGPLQISYANYVPSWAVL
VEKGLKSLGFKGIDGFSSGSLLGYSYTTTTVQPKTATRSASDDFVKTARSEKLKTLKVYT
ESLAKKVTFDDDKKATGVEVSSVGIDYTLKAKKEVIVSGGAFQSPQVLMVSGVGPKQHLE
ELDIPVVADLPGVGQNLWDHVLFGPSFEVQGLEDTLSAAINNDTVFQGALDAYAQQQAGP
LTSNQVELLGWEKAPEKYRSKFSAETIKDLATFPDDWPEMEIIPLNVYSEDWSFPILQQP
TDGKKYTSLNGALVAPLSRGNITLRTNSTTDAPLINPNFLTKKADQEVAIALFRRLREIA
KSTPLKDTVLKEVYPGEQHETDEQILAVLRDTLMTVWHAACTCKMGKKDDEMAVLDSKAR
VYGVKGLRVVDASAFPLLIPGHPVGTVYALAEKIAHDIITEEKSEGSAYKVDIDVEVS

Enzyme Prediction     

No EC number prediction in KAF6525039.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	65	639	5.1e-176	0.9929577464788732

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	4.06e-97	62	648	4	542	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	2.03e-93	65	639	5	531	choline dehydrogenase; Validated
398739	GMC_oxred_C	3.65e-40	496	634	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	2.48e-28	61	615	51	553	Protein HOTHEAD
366272	GMC_oxred_N	1.34e-24	141	380	14	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD61619.1|AA3_2	0.0	1	658	1	658
QPC62877.1|AA3_2	0.0	1	655	1	655
CZS85865.1|AA3_2	0.0	1	655	1	655
CEF88560.1|AA3_2	0.0	1	655	1	655
QPC80243.1|AA3_2	0.0	1	655	1	655

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5OC1_A	2.23e-58	65	643	1	565	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	3.15e-58	64	643	1	566	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
6ZE2_A	4.67e-55	62	647	2	591	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
3Q9T_A	1.60e-53	64	643	5	574	Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_B Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_C Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40]
5ZU3_A	2.20e-53	64	643	5	574	Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_B Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_C Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A1U8QYA8|CICC_EMENI	3.64e-155	53	641	23	610	Oxidoreductase cicC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=cicC PE=1 SV=1
sp|A1CFL2|PATE_ASPCL	4.40e-155	8	638	5	624	Patulin synthase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=patE PE=1 SV=1
sp|A0A075TRK9|PATE_PENEN	3.50e-154	53	638	40	624	Patulin synthase OS=Penicillium expansum OX=27334 GN=patE PE=1 SV=1
sp|A4UHS8|VBSA_DOTSE	2.73e-143	24	639	30	644	Versicolorin B synthase OS=Dothistroma septosporum OX=64363 GN=vbsA PE=2 SV=2
sp|M2Y151|VBSA_DOTSN	2.73e-143	24	639	30	644	Versicolorin B synthase OS=Dothistroma septosporum (strain NZE10 / CBS 128990) OX=675120 GN=vbsA PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000508	0.999470	CS pos: 21-22. Pr: 0.9766

TMHMM  Annotations     

There is no transmembrane helices in KAF6525039.1.