CAZyme Information: KAF6525037.1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: KAF6525037.1
• CAZy Family: GH63
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
244	CM024363|CGC15	26449.92	9.9250

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FoxysporumFo5176	17912	660025	0	17912

• Gene Location: location=CM024363:1114172-1114906(-)

Full Sequence      

MLSPIWNALILLTVLMATFISPAAALPNIRVLPLGDSITKGTGSTGLVGYRLPLRQKILK
QGVKVNMVGTLKNGNMVDGHHEGHSGKMLADINGYWQKPIQARPNVVLIHAGTNNMDQGK
DLDIAASILADIVDGIFKVAPDVTICLAPVIWANDKKMQANTDKFNPQVRSLISARQKKG
KHILEVPIDIKKEDLGDSKHPNDDGYEKMANAWLKAILEADKKGWLKMPIKMSPEDAPGT
GLGA

Enzyme Prediction     

No EC number prediction in KAF6525037.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE3	29	217	1.4e-50	0.9948453608247423

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238871	XynB_like	2.49e-49	29	217	1	157	SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB. Most likely a secreted hydrolase with xylanase activity. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
404371	Lipase_GDSL_2	1.94e-15	34	208	2	176	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
238141	SGNH_hydrolase	1.50e-11	31	216	1	187	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
239947	SGNH_hydrolase_YpmR_like	1.68e-08	34	216	5	204	Members of the SGNH-hydrolase superfamily, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid. This subfamily contains sequences similar to Bacillus YpmR.
238865	sialate_O-acetylesterase_like1	5.99e-08	29	217	1	187	sialate O-acetylesterase_like family of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD61617.1|CE3	1.16e-140	1	223	536	758
CEI70576.1|CE3	5.04e-137	11	244	11	244
QPC62878.1|CE3	1.30e-136	23	244	20	241
QKD52243.1|CE3	8.05e-89	7	243	8	246
CCT63634.1|CE3	4.10e-88	12	243	10	246

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VPT_A	1.40e-16	28	219	5	197	Chain A, LIPOLYTIC ENZYME [Acetivibrio thermocellus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9RLB8|CESA_RUMFL	7.73e-11	23	227	38	265	Multidomain esterase OS=Ruminococcus flavefaciens OX=1265 GN=cesA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000251	0.999733	CS pos: 25-26. Pr: 0.9718

TMHMM  Annotations     

Start	End
5	27