CAZyme Information: KAF6524931.1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: KAF6524931.1
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
477		53135.76	6.2669

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FoxysporumFo5176	17912	660025	0	17912

• Gene Location: location=CM024363:823116-824843(+)

Full Sequence      

MRSLQIISVLGALFLTTVQAVTLPAGVPRDISEFRDKHPYAPPKHEHRRIVRIRASRNNA
DDVSDEFRRGVRKANGGGTLHLAKGKTYVIGKALDLTGLEDIHIHLEGEIRFTNDVEYWQ
ENAWYHPFQKSIMFWKWGGKDIKIYGNGVIEGQGQRWWNEFESGTGSILNPDNKYYRPIL
FYAENTTNLDVSGIHLKDSPCWNNFIVSSNNVKYTDVVATALSNNGSIIPKNTDFMNTMN
TSAVRIERTWVNIDDDCFSPKPNSSDLYVNTMYCNGTHGQSMGSLGQYKGEVSNVYDVHI
ENVWMMNGDYSAARIKVWAGEETGTGFVNNVTFKNFWVARMDYGIFLDSCYFNISAEECN
AHPSGMQITNIHFENFTGYTSGVYGNAVARLSCSAAEDAICANITVKDFNVKTPCGGDPV
IICDGMHGDIGVDCVPYDSDKAKAALNAKCKTPMAAIDTDPWGSGLIEKMKGAFHPQ

Enzyme Prediction     

EC	3.2.1.67:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	71	428	6.8e-61	0.9692307692307692

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395231	Glyco_hydro_28	1.15e-38	91	427	14	316	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
177865	PLN02218	5.41e-24	62	412	82	409	polygalacturonase ADPG
215426	PLN02793	4.18e-22	136	417	135	400	Probable polygalacturonase
178580	PLN03003	8.08e-22	144	417	117	363	Probable polygalacturonase At3g15720
215540	PLN03010	1.62e-21	50	429	49	392	polygalacturonase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWW14915.1|GH28	0.0	1	477	1	477
QNQ74175.1|GH28	0.0	1	477	1	477
QKD61505.1|GH28	0.0	1	477	1	477
QNQ74174.1|GH28	0.0	1	477	1	477
UPK95511.1|GH28	0.0	1	476	1	476

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4C2L_A	1.99e-51	58	434	27	382	Crystal structure of endo-xylogalacturonan hydrolase from Aspergillus tubingensis [Aspergillus tubingensis]
1HG8_A	5.85e-15	91	378	31	303	Endopolygalacturonase from the phytopathogenic fungus Fusarium moniliforme [Fusarium verticillioides]
1RMG_A	6.70e-11	164	428	114	355	Rhamnogalacturonase A From Aspergillus Aculeatus [Aspergillus aculeatus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1DAX2|PGXB_NEOFI	7.60e-148	10	434	6	431	Probable exopolygalacturonase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=pgxB PE=3 SV=1
sp|Q0C7H7|PGXB_ASPTN	1.55e-145	44	434	45	430	Probable exopolygalacturonase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=pgxB PE=3 SV=1
sp|Q873X6|PGXB_EMENI	1.83e-145	43	434	50	436	Probable exopolygalacturonase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pgxB PE=2 SV=1
sp|Q2TW03|PGXB_ASPOR	2.02e-143	44	434	45	430	Probable exopolygalacturonase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=pgxB PE=3 SV=2
sp|B8NX60|PGXB_ASPFN	2.87e-143	44	434	45	430	Probable exopolygalacturonase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=pgxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000223	0.999762	CS pos: 20-21. Pr: 0.9817

TMHMM  Annotations     

There is no transmembrane helices in KAF6524931.1.