CAZyme Information: KAF6521915.1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: KAF6521915.1
• CAZy Family: GH3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
648		72622.73	4.9768

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FoxysporumFo5176	17912	660025	0	17912

• Gene Location: location=CM024365:650967-653897(-)

Full Sequence      

MLETYRQEMMPLFPFVWIGLDESPEKLFQERPMLYMAIMVVTCQENIEVQQELAQKYREE
IGRRIWTLTEKNLQLLQGILVFLAWYQTHWVLGHQLSNLMYMAMSLVTELGLDKEPSSGT
GTAPGVLTEITKKQEPQPVRTSDERRCHLGVFWLNSLLRICVKDIVPMPSRPSINNSCSI
FEAGLESPWDTYLVQLVRIQLVASSISATLYQDLDRNEAQISHTLFMATSHVERQVQDLG
ATLHQGSRLQAPLTMSFHMLQVYLYKIGIDERLHEPTDPTLLPAADPSPHALRCSYLLVS
CLNAVKAVIENFLLLTSPTILSMPYTYWIQMGHCINMFSRLLVTHSTLWDPNLVTGIHDF
TFLAHAYPVDHPAKFSRLIVFGDSFSDNGNGSWVVSNGTWPVDPAYYHHSFSNGPKWNDV
VAKQLNLELINLATGGATTNNDFVAGGTGAESTIPVPSAADQVLSFLSWDKPQAGDIFVH
WIGANDILFNTSITGGQVTSLINENVNRLYQAGAKTIILANYLNATTFPATYNSSTYNIP
SVQDYVPALTKGLEQIAARYSAYAKTAVIDVQDLFNDMFSDPEAYGFDEDYVNPPTACLT
GVYTSEGVPRHLCSDPEKHIFFDEYHPVKEVHTLVAKLFVESIEGFSA

Enzyme Prediction     

No EC number prediction in KAF6521915.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE16	378	638	5e-24	0.9887640449438202

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238882	fatty_acyltransferase_like	1.61e-63	377	641	1	269	Fatty acyltransferase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Might catalyze fatty acid transfer between phosphatidylcholine and sterols.
238883	Triacylglycerol_lipase_like	6.25e-26	375	636	1	274	Triacylglycerol lipase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Members of this subfamily might hydrolyze triacylglycerol into diacylglycerol and fatty acid anions.
238875	SGNH_plant_lipase_like	1.65e-25	378	643	3	315	SGNH_plant_lipase_like, a plant specific subfamily of the SGNH-family of hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
225780	COG3240	7.81e-20	372	636	26	326	Phospholipase/lecithinase/hemolysin [Lipid transport and metabolism, General function prediction only].
185279	PRK15381	2.12e-11	376	636	143	394	type III secretion system effector.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGI61065.1|CE0	8.77e-201	353	648	7	301
QPC72470.1|CE0	4.24e-161	363	647	14	300
QPC63584.1|CE0	8.50e-161	363	647	14	300
UPL02629.1|CE0	1.63e-144	352	647	4	298
UJO20625.1|CE0	2.57e-106	373	644	29	299

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6JL1_A	9.70e-20	368	637	137	404	Crystal structure of VvPlpA G389D from Vibrio vulnificus [Vibrio vulnificus]
6JL2_A	4.14e-19	368	637	137	404	Crystal structure of VvPlpA G389N from Vibrio vulnificus [Vibrio vulnificus],6JL2_B Crystal structure of VvPlpA G389N from Vibrio vulnificus [Vibrio vulnificus],6JL2_C Crystal structure of VvPlpA G389N from Vibrio vulnificus [Vibrio vulnificus]
6JKZ_A	7.39e-19	368	637	137	404	Crystal structure of VvPlpA from Vibrio vulnificus [Vibrio vulnificus],6JL0_A Crystal structure of VvPlpA from Vibrio vulnificus [Vibrio vulnificus]
6UQV_A	2.02e-15	365	637	1	279	Crystal structure of ChoE, a bacterial acetylcholinesterase from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1],6UQW_A Crystal structure of ChoE in complex with acetate and thiocholine [Pseudomonas aeruginosa PAO1],6UQW_B Crystal structure of ChoE in complex with acetate and thiocholine [Pseudomonas aeruginosa PAO1],6UQX_A Crystal structure of ChoE in complex with propionylthiocholine [Pseudomonas aeruginosa PAO1],6UQX_B Crystal structure of ChoE in complex with propionylthiocholine [Pseudomonas aeruginosa PAO1]
6UR1_A	4.94e-15	365	637	1	279	Crystal structure of ChoE S38A mutant in complex with acetate and acetylthiocholine [Pseudomonas aeruginosa PAO1],6UR1_B Crystal structure of ChoE S38A mutant in complex with acetate and acetylthiocholine [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A2Z5U1Z1|HIMD_ASPJA	1.01e-20	1	361	125	468	Transcription factor himD OS=Aspergillus japonicus OX=34381 GN=himD PE=3 SV=1
sp|Q99289|HLT_VIBPA	1.43e-20	372	642	141	409	Thermolabile hemolysin OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=VPA0226 PE=1 SV=2
sp|P10480|GCAT_AERHY	3.05e-16	370	603	20	248	Phosphatidylcholine-sterol acyltransferase OS=Aeromonas hydrophila OX=644 PE=1 SV=3
sp|A7J2C6|AES1_HYPJE	1.29e-09	346	647	3	339	Acetylesterase OS=Hypocrea jecorina OX=51453 GN=aes1 PE=1 SV=1
sp|Q8VY93|GDL66_ARATH	1.30e-08	373	636	25	339	GDSL esterase/lipase At4g26790 OS=Arabidopsis thaliana OX=3702 GN=At4g26790 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000067	0.000000

TMHMM  Annotations     

There is no transmembrane helices in KAF6521915.1.