CAZyme Information: KAF6521579.1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: KAF6521579.1
• CAZy Family: GT90
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
458		51265.50	4.9801

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FoxysporumFo5176	17912	660025	0	17912

• Gene Location: location=CM024366:3697448-3698961(-)

Full Sequence      

MPEEYISMLKSLPSEVDKVKEPVVGVATVDVTIQTGPPRHLASGILYGIPDRPDQIPDHF
YKDLGFNYGRGGGSQLPGTKGYAVSLEDYKARFASALSNYRTTRKHGGEFIYLLPAAWGA
DGGQSENFAYPGDNDDWTSWDAFLERTLDDVKKSDMIEGLVIDIWNEPDLSFFWNRSMEQ
WLELWTRSFKKIREALPSVRITGPSMSAIPSTSHEWWSAFLSRCKDSLPDQWSWHMEGGD
EAVTMASSMASFHDLLSKYDIPLDKAQDVNINEYAVYGEQVPSAGAWWIAGLERENAHGL
RGNWAIAGALHDFMAGLLNKPNGSGGSYAIEGEGYWPTAEFQVYRYYASRMKGQRLKTTA
SSDGLFDAYATVEGDVLRILAGTRSRPGNWTIDVVGLTDDTRVKVKTLAFRVVDGDKFKR
VDGPHDLEEREEVVKEGKLKLRMKHQDPTTAFAFELSV

Enzyme Prediction     

No EC number prediction in KAF6521579.1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395983	Glyco_hydro_39	4.70e-05	163	224	153	211	Glycosyl hydrolases family 39.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD55516.1|GH39	0.0	1	458	1	458
QGI82700.1|GH39	8.68e-315	1	458	1	466
QGI96329.1|GH39	8.68e-315	1	458	1	466
QGI65448.1|GH39	8.68e-315	1	458	1	466
CCT69625.1|GH39	9.50e-313	8	458	1	451

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5U22_A	2.88e-06	139	294	119	270	Structure of N2152 from Neocallimastix frontalis [Neocallimastix frontalis]

Swiss-Prot Hits     

KAF6521579.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000038	0.000000

TMHMM  Annotations     

There is no transmembrane helices in KAF6521579.1.