CAZyme Information: KAF6519396.1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: KAF6519396.1
• CAZy Family: GT90
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
705	CM024368|CGC6	80813.15	7.1237

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FoxysporumFo5176	17912	660025	0	17912

• Gene Location: location=CM024368:2778287-2781383(+)

Full Sequence      

MDVPVAANILGTLGAVCWSIQLIPQIIVNYRRHNATGLQPSMMMLWAWAGVPLGVYNIVK
EFNIALRIQPQILTLLSLVTWIQCYYYERKWSVYRSLLVVVPIAAVMGGIQASLIIALRI
AKSRSLEWPLILMASLSAALLAAGVLTHYWDIWKHRTVRGISFLFVAIDAAGDVFSLVSV
FFQPELDVLGIVIYATEFVLWCGVFACGGYYNLLPWVRKSRMAIAGLCTVVFLILVFWGA
IHGSYGVSQYYSFSTTSSFRPVSVDPEGKTTQDLCATFPKHLLQTIQPVLKMGHADTKER
LDAQFDSVSACFGKDELLVISDLDESVHDHQAIDVLADLPAIYYHDNPDFVNYMWQKEMR
ANGTLDVDLEATARIQGWRMDKFKFLPMIERAWKMKPNKDFYFFFETDTYVFWDNAFRFL
QTFDPDAPLYMGSPSPGTHDVKQDIKTWFANGGPGFVLSRGAMRALLVRKTTPYGQYVEP
PATEKWLPMLRDDCCGDSVTGWALWNVSVPLRGYWPLFNPHPLHSIPFSDKYWCQPVMTL
HKSSPKDMVDVWRWEFAQRQLGRPLLYSDVWKFHHPGDREVAENWDNGKWDFTVAPPEAK
IDSFEACGKYCKDSSDCLQYNWRGRDEKKCVTSKSFRVGEPRQPEKIIEPEVKDDKGNVI
PPPPDRQDRWVDFKSGWLTERIEQWRSNRNCSEVQWVGPSTKRIF

Enzyme Prediction     

No EC number prediction in KAF6519396.1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398045	PQ-loop	2.14e-15	6	66	1	61	PQ loop repeat. Members of this family are all membrane bound proteins possessing a pair of repeats each spanning two transmembrane helices connected by a loop. The PQ motif found on loop 2 is critical for the localization of cystinosin to lysosomes. However, the PQ motif appears not to be a general lysosome-targeting motif. It is thought likely to possess a more general function. Most probably this involves a glutamine residue. Family members are membrane transporters since two members, cystinosin and PQLC2, transport cystine and cationic amino acids, respectively, across the lysosomal membrane. The 2nd PQ-loop of cystinosin hosts the substrate-coupled H+ binding site underlying its H+ symport mechanism, suggesting that PQ-loop repeats have functional significance. It is thus likely that PQ-loop-containing proteins act as a family of membrane transporters. Some transport cystine and cationic amino acids, respectively, across the lysosomal membrane. Others transport lysine and or arginine across the lysosomal membrane in order to maintain the acidic homoeostasis.
367085	Fringe	9.32e-07	405	494	91	181	Fringe-like. The drosophila protein fringe (FNG) is a glucosaminyltransferase that controls the response of the Notch receptor to specific ligands. FNG is localized to the Golgi apparatus (not secreted as previously thought). Modification of Notch occurs through glycosylation by FNG. The xenopus homolog, lunatic fringe, has been implicated in a variety of functions.
128923	CTNS	7.60e-05	20	46	1	27	Repeated motif present between transmembrane helices in cystinosin, yeast ERS1p, mannose-P-dolichol utilization defect 1, and other hypothetical proteins. Function unknown, but likely to be associated with the glycosylation machinery.
398045	PQ-loop	1.36e-04	149	183	21	55	PQ loop repeat. Members of this family are all membrane bound proteins possessing a pair of repeats each spanning two transmembrane helices connected by a loop. The PQ motif found on loop 2 is critical for the localization of cystinosin to lysosomes. However, the PQ motif appears not to be a general lysosome-targeting motif. It is thought likely to possess a more general function. Most probably this involves a glutamine residue. Family members are membrane transporters since two members, cystinosin and PQLC2, transport cystine and cationic amino acids, respectively, across the lysosomal membrane. The 2nd PQ-loop of cystinosin hosts the substrate-coupled H+ binding site underlying its H+ symport mechanism, suggesting that PQ-loop repeats have functional significance. It is thus likely that PQ-loop-containing proteins act as a family of membrane transporters. Some transport cystine and cationic amino acids, respectively, across the lysosomal membrane. Others transport lysine and or arginine across the lysosomal membrane in order to maintain the acidic homoeostasis.
130026	2A43	0.006	9	118	6	129	Lysosomal Cystine Transporter. [Transport and binding proteins, Amino acids, peptides and amines]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD58826.1|GT31	0.0	218	705	17	504
QGI98269.1|GT31	0.0	218	705	17	504
QGI84613.1|GT31	0.0	218	705	17	504
QGI67386.1|GT31	0.0	218	705	17	504
CCT71629.1|GT31	0.0	218	705	17	504

PDB Hits     

KAF6519396.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q10227|YD03_SCHPO	4.70e-46	6	214	18	225	Uncharacterized protein C2E12.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC2E12.03c PE=4 SV=1
sp|Q03193|YD090_YEAST	6.99e-31	6	202	6	214	Uncharacterized membrane protein YDR090C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YDR090C PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000020	0.000000

TMHMM  Annotations     

Start	End
5	27
42	59
96	118
128	150
163	182
192	214
223	245