CAZyme Information: KAF6518581.1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: KAF6518581.1
• CAZy Family: GH128
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
780		88697.03	5.2781

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FoxysporumFo5176	17912	660025	0	17912

• Gene Location: location=CM024368:139963-142574(+)

Full Sequence      

MNELEVEWVGETAWTYRTTFDSPSANSRSVYLVFEGLDTFAQVKLNDVIILESDNMFLSH
RVDVTNKLSNEGPNVLSIDFDSALLKAREIKEQYPDHRWELFNGEAGRLVVRKAQYHWGW
DWGPVLNTAGPWKPVWLEVSSAHINDFLLKYTVSPDLEKIQGTVEVDIEGLYDTANVSIN
FQDDAVYTTTAAKPSDGRLVVPFAIDQPKLWYPAGYGHQPQYSVSVSIVKDSQKLDAKTK
KTGFRRSELVQRGDSHGKSFFFRINNIDIFCGGSCWIPADNLLPRITPAKYRDWLKLMIE
GNQIMTRVWGGGIYEDDAFYDCCDEMGILVWQDFMFGCGNYPVGPSLIKSIREEAVQNVG
RLHHHPSIVIYAGNNEDYQVQEQAGLEYNPDDKDPSSWLKSSFPARYYYEYLLPEVVNEV
SPGMIYWPGSPFSGGKDTADKTTGDLHQWNVWHGTQEKYQVFDRLGGRFNSEFGMEAFPA
LSTIKHCITEDCDRFPQSQMMDFHNKADGHERRIATYVVENFRPLPDLESHIYLTQVCQS
EAMTFAYRSWRRQWGDDRRCGGVLVWQMNDCWPAISWSIVDYFLTKKPAYYSIRRALKPI
AAGVQRQHHDWSVVHARPAKTSSFEVWVASSKQQEVTVTVEIRFISIKTGRDIRDKIVKA
NTVLVPNGTTDILTGQIDNAKDEPHVISVSVLQSGVCVSQDVDWPQPLKYLDFSDRGVQI
QVGPDGYQLTASKPTKGLVFEELPGVSLEDNCIDLMPGEVVTVKARGSEMLSGVPKYRYL

Enzyme Prediction     

EC	3.2.1.25:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	11	653	1.5e-93	0.6077127659574468

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225789	LacZ	4.52e-80	5	594	56	627	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
407658	Mannosidase_ig	4.61e-13	622	710	1	91	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.
395572	Glyco_hydro_2	1.95e-08	142	245	1	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
407625	Ig_mannosidase	0.007	718	763	6	54	Ig-fold domain. This Ig-like fold domain is found in mannosidase enzymes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD57951.1|GH2	0.0	1	780	53	832
CCT70824.1|GH2	0.0	1	780	53	832
QGI83791.1|GH2	0.0	1	780	53	832
QGI66550.1|GH2	0.0	1	780	53	832
QGI97440.1|GH2	0.0	1	780	53	832

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5N6U_A	2.30e-131	2	605	70	661	Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_B Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_C Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_D Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12]
6BYE_A	2.16e-105	2	772	59	839	Crystal structure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306],6BYE_B Crystal structure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306]
2VJX_A	2.18e-105	1	759	51	810	Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]
6BYC_A	2.21e-105	2	772	59	839	Crystal structure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
2JE8_A	2.28e-105	1	759	53	812	Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JE8_B Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0CCA0|MANBB_ASPTN	0.0	3	780	55	841	Beta-mannosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mndB PE=3 SV=2
sp|Q2TXB7|MANBB_ASPOR	0.0	2	780	54	842	Beta-mannosidase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=mndB PE=3 SV=3
sp|B0YBU9|MANBB_ASPFC	0.0	2	780	54	843	Beta-mannosidase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=mndB PE=3 SV=1
sp|A1CGA8|MANBB_ASPCL	0.0	2	780	54	843	Beta-mannosidase B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=mndB PE=3 SV=1
sp|B8NW36|MANBB_ASPFN	0.0	2	780	54	842	Beta-mannosidase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=mndB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000071	0.000000

TMHMM  Annotations     

There is no transmembrane helices in KAF6518581.1.