CAZyme Information: KAF6516903.1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: KAF6516903.1
• CAZy Family: PL1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
711	CM024370|CGC3	74883.22	4.3476

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FoxysporumFo5176	17912	660025	0	17912

• Gene Location: location=CM024370:2417496-2420748(-)

Full Sequence      

MGSFTFKWEHPADEVYVTGTFDNWTKSVQLEKEGNVFSKTVDLKEPEGKIYYKVRQRQRA
STRNPNSISPFRHSIRIWHWFGTTQILPSSPALKTNIRTPNEPDLEGNVNNFITPDQLNT
ETPGAAILNTVTPSSTTAAMAAEQPIENKPTEEKTLGDKPTQDEKLPLETPSDIPGGFPA
TPANELDTTIGINPLPASEGAGNPIKLEPGEKIPESITAQSTDKYVKLDKESYEKSDALP
GIETELPPVSSNTIPESSLPIIGAQDVVINSAAPTATTAGLAAEVPLESNGAFVPEVVRE
SQEKAGAVTEASTDPTEVKEKTMVEEELKGTVPEAPATSVGTAGVGTEKSENTPDTSLAA
LAATAGGAVIAAGLAAKETVEEKASPALNSAADAITDTANKNLPDSVKEQLPVAAQETLA
AKNEEQIRQEVSPEVPVEVKESLVEAGKSPEAAANTAAVEDKKEVENELLKEVKPVTGIY
DSVVEQPKEEPKQVSPEVPVEVKDSIAEAGKSPEAAANTEAVEEKKLVEAELLKEVKPAA
TIDETAKVAPEVPTEVKESIVEAGERPEAAASTEAVENKKEVEAQLLKEAEPVPAVDEVK
PQETESAVPAVAAPVAAPLETKAVEAKPDAEPVTKPEEPKAEAKTETPAVGNGSSATGNG
TTTTGNGAKATETKATTPANGSSSTANGEKKKKHNRLSSIFSKIKHKLSDK

Enzyme Prediction     

No EC number prediction in KAF6516903.1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
406865	AMPK1_CBM	2.77e-15	5	53	4	50	Glycogen recognition site of AMP-activated protein kinase. AMPK1_CBM is a family found in close association with AMPKBI pfam04739. The surface of AMPK1_CBM reveals a carbohydrate-binding pocket.
199889	E_set_AMPKbeta_like_N	1.62e-13	3	53	1	51	N-terminal Early set domain, a glycogen binding domain, associated with the catalytic domain of AMP-activated protein kinase beta subunit. E or "early" set domains are associated with the catalytic domain of AMP-activated protein kinase beta subunit glycogen binding domain at the N-terminal end. AMPK is a metabolic stress sensing protein that senses AMP/ATP and has recently been found to act as a glycogen sensor as well. The protein functions as an alpha-beta-gamma heterotrimer. This N-terminal domain is the glycogen binding domain of the beta subunit. This domain is also a member of the CBM48 (Carbohydrate Binding Module 48) family whose members include pullulanase, maltooligosyl trehalose synthase, starch branching enzyme, glycogen branching enzyme, glycogen debranching enzyme, and isoamylase.
173412	PTZ00121	9.01e-08	296	643	1346	1690	MAEBL; Provisional
236766	rne	3.77e-07	475	679	846	1027	ribonuclease E; Reviewed
173412	PTZ00121	4.19e-06	392	693	1280	1571	MAEBL; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD54653.1|CBM48	0.0	1	711	1	692
QGI81967.1|CBM48	0.0	1	711	1	695
CCT68761.1|CBM48	0.0	1	711	1	695
QGI64706.1|CBM48	0.0	1	711	1	695
QGI95592.1|CBM48	0.0	1	711	1	695

PDB Hits     

KAF6516903.1 has no PDB hit.

Swiss-Prot Hits     

KAF6516903.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000049	0.000000

TMHMM  Annotations     

There is no transmembrane helices in KAF6516903.1.