CAZyme Information: KAF6516139.1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: KAF6516139.1
• CAZy Family: CBM67|GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1210		132947.98	6.3375

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FoxysporumFo5176	17912	660025	0	17912

• Gene Location: location=CM024371:2568508-2572140(+)

Full Sequence      

MSDDCSSNPIPLRQFNPLNFHATTCNLKWNNGCTRNKNGQLQQKPPPFLLCNSGQFPSGL
IPVDAYTLAMQTRDAGSPQNSAKYTLHGLWPSSAGGNGARDQPYGCLNGEEFDEGILKTF
GDLLSYFWPTDPKFGNTMQCFILSEWMKHGTCAVIPGADGNAFRLSQEAYFRTAFVLANE
FNANAALRQQLDEPGSEDLESNVSTGCVQCAYLATVDWEGTDVQSVPRMSGDCVNQCFAC
GDSWDICPPAQLNSTVELDPSNAPVDTSDSGTNSDGLANFAVLDFAMPAFISNNTSPWEG
TWRSFGAEQGGSGKFQFAQTFTDKVLTVTTDSPYPQTCSYERLGPKELVLRCGGNRLEEC
LVQRLPDIGGLEAAFLACNHTGQPAPASFYTAMDTPGCGNFLMFRCKASAEGCSFSPDAT
SAASKSKTKTKSGSDSEPSLVSHSQPGIAGAPTKLLGLWRSLQVSSHYEEGLANWSFTSD
GQASVKWPNHPERGVERYSVSHSREDPGKVLLSTASGVITTCRFKFQYQPVYSYAVLDCT
AGDKKTQWAMGRCNPCSAECRYSCSAENDNCGAGSCDPSESSSAGALPSPQGDSDHRWCT
PEDSSCWPTKTAIDKLEKALDPTVPRLGVQWSNYPAPQPAPVPTGSINNQAFYGLGSKGL
KALYYYEDIAEMQRPCFNIRDGVNIWNTASDMCKAALHQNEYRNWNPFIVVFPLNQRHIT
AALKFAAQHRLCIATAGTGHEYNSRNSCPTGGILIRTILLKNKEFLPTWSEDQALAPAGA
FRFGAGSIFAEMHAFSAKYDRVVASGWCSTVGMTGYHLGGGHGPFAPSMGLGVDNVLEIE
VLQVGRNIHGRTVVHKKIVSRRKNPQLFWAMRGGGGGVWGVILSMTLRAHAVPDGGLSRV
FVSQTGTFCPGSQNKFGYEWLREMWPRFAQWQLRLNSKVSTQPGFFIDTSKYKKGDLCTA
TWTFNFEYFYTGGQKEQDYVMFRDSLKDLLQTKTVQEDNFNSAYDYLLSMPPNKFQITVM
NPLPAPHEPSDDATGSQNSVFVSREDMETKFASTMMDVLDICVNTLKTPDKTSPDPMGYR
CGFHYLYTSITGNLGSSQPGDTAISPGFRSGLMLWNARTLSTKQCEDTIYRLGSNSYFSE
SSYVMHNWTDRYWGEKKYKQLLAVKRAHDPGNLFWCHHCVGDDPDDAYGNPLGVKKAQDV
KVDSYKKDEL

Enzyme Prediction     

EC	1.1.3.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA7	697	895	1.6e-39	0.3930131004366812

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238220	RNase_T2	1.84e-14	64	196	2	129	Ribonuclease T2 (RNase T2) is a widespread family of secreted RNases found in every organism examined thus far. This family includes RNase Rh, RNase MC1, RNase LE, and self-incompatibility RNases (S-RNases). Plant T2 RNases are expressed during leaf senescence in order to scavenge phosphate from ribonucleotides. They are also expressed in response to wounding or pathogen invasion. S-RNases are thought to prevent self-fertilization by acting as selective cytotoxins of "self" pollen.
396238	FAD_binding_4	7.40e-13	707	842	1	129	FAD binding domain. This family consists of various enzymes that use FAD as a co-factor, most of the enzymes are similar to oxygen oxidoreductase. One of the enzymes Vanillyl-alcohol oxidase (VAO) has a solved structure, the alignment includes the FAD binding site, called the PP-loop, between residues 99-110. The FAD molecule is covalently bound in the known structure, however the residue that links to the FAD is not in the alignment. VAO catalyzes the oxidation of a wide variety of substrates, ranging form aromatic amines to 4-alkylphenols. Other members of this family include D-lactate dehydrogenase, this enzyme catalyzes the conversion of D-lactate to pyruvate using FAD as a co-factor; mitomycin radical oxidase, this enzyme oxidizes the reduced form of mitomycins and is involved in mitomycin resistance. This family includes MurB an UDP-N-acetylenolpyruvoylglucosamine reductase enzyme EC:1.1.1.158. This enzyme is involved in the biosynthesis of peptidoglycan.
238512	RNase_T2_euk	1.38e-11	85	190	31	124	Ribonuclease T2 (RNase T2) is a widespread family of secreted RNases found in every organism examined thus far. This family includes RNase Rh, RNase MC1, RNase LE, and self-incompatibility RNases (S-RNases). Plant T2 RNases are expressed during leaf senescence in order to scavenge phosphate from ribonucleotides. They are also expressed in response to wounding or pathogen invasion. S-RNases are thought to prevent self-fertilization by acting as selective cytotoxins of "self" pollen. Generally, RNases have two distinct binding sites: the primary site (B1 site) and the subsite (B2 site), for nucleotides located at the 5'- and 3'- terminal ends of the sessil bond, respectively. This CD includes the eukaryotic RNase T2 family members.
395357	Ribonuclease_T2	1.68e-11	78	189	24	124	Ribonuclease T2 family.
223354	GlcD	4.78e-08	679	841	2	159	FAD/FMN-containing dehydrogenase [Energy production and conversion].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD57322.1|GH43_11	1.71e-17	707	893	598	775
QKD57322.1|CBM91|GH43_11	1.71e-17	707	893	598	775
UNI23960.1|AA7	1.87e-10	707	932	48	244
EGX49222.1|AA7|CBM1	2.96e-09	705	894	162	335
UQC87672.1|AA7	4.27e-09	676	894	39	239

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6F72_A	3.49e-23	707	1183	124	561	Crystal structure of VAO-type flavoprotein MtVAO615 at pH 7.5 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F73_A Crystal structure of VAO-type flavoprotein MtVAO615 at pH 5.0 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F73_B Crystal structure of VAO-type flavoprotein MtVAO615 at pH 5.0 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464]
6FYE_A	2.70e-12	682	892	20	211	The crystal structure of EncM H138T mutant [Streptomyces maritimus],6FYE_B The crystal structure of EncM H138T mutant [Streptomyces maritimus]
4UD8_A	4.37e-12	704	893	79	255	AtBBE15 [Arabidopsis thaliana],4UD8_B AtBBE15 [Arabidopsis thaliana]
6FYD_A	6.26e-12	682	892	20	211	The crystal structure of EncM T139V mutant [Streptomyces maritimus],6FYD_B The crystal structure of EncM T139V mutant [Streptomyces maritimus],6FYD_C The crystal structure of EncM T139V mutant [Streptomyces maritimus],6FYD_D The crystal structure of EncM T139V mutant [Streptomyces maritimus]
6EO4_A	6.59e-12	690	950	31	262	Physcomitrella patens BBE-like 1 wild-type [Physcomitrium patens],6EO4_B Physcomitrella patens BBE-like 1 wild-type [Physcomitrium patens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A0E0RTV6|ZEB1_GIBZE	4.14e-23	599	1183	29	550	FAD-linked oxidoreductase ZEB1 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=ZEB1 PE=2 SV=2
sp|G2QDQ9|VAO15_MYCTT	1.80e-22	707	1183	124	561	VAO-type flavoprotein oxidase VAO615 OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=MYCTH_2305637 PE=1 SV=1
sp|L0E2Q5|PHQH_PENFE	3.64e-22	719	924	131	328	FAD-linked oxidoreductase phqH OS=Penicillium fellutanum OX=70095 GN=phqH PE=3 SV=1
sp|D4B1Z7|A2478_ARTBC	5.28e-22	707	1183	122	560	Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_02478 PE=1 SV=1
sp|L0E159|MALF_MALAU	1.40e-21	599	891	27	302	FAD-linked oxidoreductase malF OS=Malbranchea aurantiaca OX=78605 GN=malF PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999934	0.000091

TMHMM  Annotations     

There is no transmembrane helices in KAF6516139.1.