CAZyme Information: KAF6516096.1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: KAF6516096.1
• CAZy Family: CBM67|GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1606	CM024371|CGC4	185251.67	6.7093

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FoxysporumFo5176	17912	660025	0	17912

• Gene Location: location=CM024371:2396896-2402857(-)

Full Sequence      

MERRDFELPDPDWMRDLSHCPLSDRDKELLEKFWTELENDRMEHCARCQETWFDMGLKGG
ICKRCIARDKNKKEDEPWFFSAENQLDFGLIPAFLPQLTIVEEMLIARVHVFVNVMQVRG
QQYKYRGHIVHFLRDVGKVYSQLPLLPPELDVILLRPPTASEHAHLNRQFRRQFRVRRRC
LQEWLNFLSNNHPGYRGITVCQKRMSVLPEDGDVLDQVATAAVTDPLSANLGNIENDDVE
PDEVDQSAVPDLLPEDTEMEALRSHVLGEERGEHLPYADYIQHALRWHDGRFARHPTFRF
VVFNTLMRAQARAKSSYFVKEYQQRQGLITRDDLLEAFQNPESAEAQQLLNSINRQTAQL
RGTRPYWYRKRRELESYAYNLDCPGAFITFSPADLHWRSLYQHLPQFQDWQELPEQQRMG
MSSKLLRDNPHIAAWHFYRRFGLFRDIVLKQKFNVTDYWNRYEWQGRGSSHCHGLFWMDG
APSVDLENEHLRKEFARIWRFHVTAFNPEPARVRQQGEGNPLAVNPLQHPLTFQWLSQVL
NRCQRHHCSETYCLRKKKGSEEISCRFFFPRDTRDTADVVRRQGQSYFSFEAARNDSLMN
HYNRCLSLGWLANIDISPCTSLQAVINYAAKYCSKMEKRTDSYASMGRQILPYVSHQNPL
LSFASRLMNKLLTERDFSGQEICHVLLNCELQEGTRVIRAVDCRPYEQQGRSLRLQGDHD
DAEVVGIYEKYLSRPPLHEELTYLDFLANWNTSNRDGRKWTRWSRQAKPRVLYYFPRYKS
NPQHHQYDGFCRVKLMLAHPHRDPNELRKINGVEYNSYASAAEFCYGNHRHPDDYYGTPN
AEERRPDPDEFEEEFHEPDLLEEDWLELARQLPDCPPSQEAIDLLGRRDIDIQYDWTPHV
GRYADPGIVQGDYWRQRIEQNRLYMDVEDMSLEVRDTLNSEQRIVYDTFIGHFQCGSEEQ
ILLHVDGGGGTGKSYMVKVLSSHLQRLAGNRPSPIWRAAPTGVASNQIMGTTLHSLLRLP
VDRAFTELSPADANAVQNKLRDVRYLVIDEKSMLGLRQLSWIDKRLRQVFPARAAEFFGG
ISIILVGDFFQLPPIANKPLYFDGPLKDLHEVSGQTAYRAFNHTVFLKKVQRQQGDDQAG
FRLALEELRGLKLSIESWKLLSQRVQVKLSQREEDTFDAALRIYSKKARVNEYNYEHLVR
LKHPAIQVMAKNIGNGADKATSEQAGNLAGQFPPAGLVNGAQGTVYDIGWAPGADAHRDP
PSVIMMVMDKYTGPSYLTTDDGREVVPILPVKRDFFLGTSACTRKQFPLMASYAITVHKS
QSITVDKMVTDLSERDFQTGLSYVAVSRVKMLDGTELHWPARKYIIQIARFDPSKGIPTA
IDSYAEFRRQCKVADIEDTPQLVLCGNQSVDDPDASIVYDQTLDQIMSLCPELMKDISVM
CLVPNDQLLNTLISKAHVVLQLSTSEGFEVKVSEALHAGRPVVATKTGGLPLQIKDSVNG
FLVEPGDWRAVASHLMDLFTNNALYERMSHAARTGVSDEVGTVSNALCWFYLASKWRDIG
TKESGKAVLQPHERWVYDMARDEANCPYSADEEQLPRCSIEDKKIN

Enzyme Prediction     

EC	2.4.1.231:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	1361	1529	2.7e-33	0.94375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340823	GT4_trehalose_phosphorylase	2.48e-77	1355	1556	190	378	trehalose phosphorylase and similar proteins. Trehalose phosphorylase (TP) reversibly catalyzes trehalose synthesis and degradation from alpha-glucose-1-phosphate (alpha-Glc-1-P) and glucose. The catalyzing activity includes the phosphorolysis of trehalose, which produce alpha-Glc-1-P and glucose, and the subsequent synthesis of trehalose. This family is most closely related to the GT4 family of glycosyltransferases.
404983	Helitron_like_N	2.02e-65	281	476	1	197	Helitron helicase-like domain at N-terminus. This family is found in Helitrons, recently recognized eukaryotic transposons that are predicted to amplify by a rolling-circle mechanism. In many instances a protein-coding gene is disrupted by their insertion.
350795	DEXSc_Pif1_like	1.18e-35	965	1132	17	183	DEAD-box helicase domain of Pif1. Pif1 and other members of this family are RecD-like helicases involved in maintaining genome stability through unwinding double-stranded DNAs (dsDNAs), DNA/RNA hybrids, and G quadruplex (G4) structures. The members of Pif1 helicase subfamily studied so far all appear to contribute to telomere maintenance. Pif1 is a member of the DEAD-like helicases superfamily, a diverse family of proteins involved in ATP-dependent RNA or DNA unwinding. This domain contains the ATP-binding region.
395425	Glycos_transf_1	1.09e-21	1362	1533	2	156	Glycosyl transferases group 1. Mutations in this domain of PIGA lead to disease (Paroxysmal Nocturnal haemoglobinuria). Members of this family transfer activated sugars to a variety of substrates, including glycogen, Fructose-6-phosphate and lipopolysaccharides. Members of this family transfer UDP, ADP, GDP or CMP linked sugars. The eukaryotic glycogen synthases may be distant members of this family.
223515	RfaB	1.36e-20	1360	1533	197	354	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD62123.1|GT4	9.62e-153	1355	1606	491	742
QPC63359.1|GT4	3.64e-123	1356	1606	542	792
AEO68370.1|GT4	3.18e-107	1355	1605	365	615
AEO59616.1|GT4	4.04e-105	1355	1605	442	692
VBB80726.1|GT4	1.18e-103	1355	1605	570	820

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5FTB_A	2.82e-22	965	1354	26	396	Crystal structure of Pif1 helicase from Bacteroides in complex with AMPPNP [Bacteroides sp. 3_1_23],5FTC_A Crystal structure of Pif1 helicase from Bacteroides in complex with ADP [Bacteroides sp. 3_1_23],5FTD_A Crystal structure of Pif1 helicase from Bacteroides apo form [Bacteroides sp. 3_1_23],5FTE_A Crystal structure of Pif1 helicase from Bacteroides in complex with ADP-AlF3 and ssDNA [Bacteroides sp. 3_1_23]
5FHD_A	3.77e-22	965	1354	26	396	Structure of Bacteroides sp Pif1 complexed with tailed dsDNA resulting in ssDNA bound complex [Bacteroides fragilis],5FHD_B Structure of Bacteroides sp Pif1 complexed with tailed dsDNA resulting in ssDNA bound complex [Bacteroides fragilis],5FHE_A Crystal structure of Bacteroides Pif1 bound to ssDNA [Bacteroides fragilis],5FHF_A Crystal structure of Bacteroides sp Pif1 in complex with ADP-AlF4 [Bacteroides fragilis],5FHG_A Structure of unliganded Pif1 from Bacteroides sp [Bacteroides fragilis],5FHG_B Structure of unliganded Pif1 from Bacteroides sp [Bacteroides fragilis],6L3G_A Chain A, ATP-dependent DNA helicase [Bacteroides sp. AF32-8BH],6L3G_B Chain B, ATP-dependent DNA helicase [Bacteroides sp. AF32-8BH]
5FTF_A	9.02e-22	965	1354	26	396	Crystal structure of Pif1 helicase from Bacteroides double mutant L95C-I339C [Bacteroides sp. 3_1_23]
6ZJ4_AAA	7.00e-17	1362	1536	213	375	Chain AAA, Trehalose phosphorylase/synthase [Thermoproteus uzoniensis],6ZJ7_AAA Chain AAA, Trehalose phosphorylase/synthase [Thermoproteus uzoniensis 768-20],6ZJH_AAA Chain AAA, Trehalose phosphorylase/synthase [Thermoproteus uzoniensis 768-20],6ZMZ_AAA Chain AAA, Trehalose phosphorylase/synthase [Thermoproteus uzoniensis],6ZN1_AAA Chain AAA, Trehalose phosphorylase/synthase [Thermoproteus uzoniensis]
7LCC_A	1.76e-16	936	1350	1031	1459	Chain A, Helraiser K1068Q [synthetic construct]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O75003|TREPH_GRIFR	1.71e-73	1356	1597	489	725	Trehalose phosphorylase OS=Grifola frondosa OX=5627 PE=1 SV=1
sp|A6YRN9|TREPH_PLEPU	3.51e-66	1356	1601	493	736	Trehalose phosphorylase OS=Pleurotus pulmonarius OX=28995 GN=TP PE=2 SV=1
sp|Q9UV63|TREPH_PLESA	1.21e-63	1356	1601	505	748	Trehalose phosphorylase OS=Pleurotus sajor-caju OX=50053 GN=TP PE=1 SV=1
sp|Q6MHJ5|PIF1_BDEBA	2.07e-21	967	1366	54	425	ATP-dependent DNA helicase pif1 OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100) OX=264462 GN=pif1 PE=3 SV=1
sp|A5WFR0|PIF1_PSYWF	1.21e-18	967	1357	20	444	ATP-dependent DNA helicase pif1 OS=Psychrobacter sp. (strain PRwf-1) OX=349106 GN=pif1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000053	0.000000

TMHMM  Annotations     

There is no transmembrane helices in KAF6516096.1.