CAZyme Information: KAF6514789.1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: KAF6514789.1
• CAZy Family: AA7
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
367		37366.64	3.7444

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FoxysporumFo5176	17912	660025	0	17912

• Gene Location: location=JACDXP010000015:1636330-1637482(+)

Full Sequence      

MQYRVIMAATLAIGAYAAPAPLITGAPSLSRRQDSESGSGGSGGSSVLDAPMTIAAGESF
DGGNAIFDRGVSCTGQVEGGDSDAVFILEKGATLSNVRIGPNQIEGVHCNGGCTLNNVVW
DAVCEDAFSIKKQEDGETTTINGGGATGAEDKVIQHNGGGTVIIKDFEVSDFGKLYRSCG
NCKEMPARHVEISGGSASNGKILVGINPNMGDTAKISGIQLTNVPKECITFEGVTDGSEP
KEVGTCDSNAGSGSGSGSGDSTEAPATPTTPADGSETPAASEVADPVETSADGSQGDDQS
GDDQSGDNDDGDNDESDDDKKDDDSDDENKDEQSDNENQDQESESDNQQAQPSQPNFSFG
SGGFGGF

Enzyme Prediction     

No EC number prediction in KAF6514789.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL3	44	233	5.3e-72	0.9845360824742269

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397360	Pectate_lyase	4.66e-103	47	238	12	200	Pectate lyase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGJ00946.1|PL3_2	4.50e-206	1	367	1	367
QGI70056.1|PL3_2	4.50e-206	1	367	1	367
QKD60682.1|PL3_2	1.86e-204	1	367	1	373
CCT74639.1|PL3_2	1.33e-201	7	367	1	361
QGI87418.1|PL3_2	6.91e-196	1	358	1	363

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3B90_A	5.96e-25	68	242	11	205	Chain A, Endo-pectate lyase [Dickeya chrysanthemi],3B90_B Chain B, Endo-pectate lyase [Dickeya chrysanthemi]
1EE6_A	1.55e-24	47	238	4	188	Crystal Structure Of Pectate Lyase From Bacillus Sp. Strain Ksm-P15. [Bacillus sp. KSM-P15]
3B4N_A	3.81e-24	51	242	111	323	Chain A, Endo-pectate lyase [Dickeya chrysanthemi],3B4N_B Chain B, Endo-pectate lyase [Dickeya chrysanthemi],3B8Y_A Chain A, Endo-pectate lyase [Dickeya chrysanthemi],3B8Y_B Chain B, Endo-pectate lyase [Dickeya chrysanthemi]
4EW9_A	2.38e-19	43	181	5	139	The liganded structure of C. bescii family 3 pectate lyase [Caldicellulosiruptor bescii DSM 6725],4EW9_B The liganded structure of C. bescii family 3 pectate lyase [Caldicellulosiruptor bescii DSM 6725]
3T9G_A	2.44e-19	43	181	6	140	The crystal structure of family 3 pectate lyase from Caldicellulosiruptor bescii [Caldicellulosiruptor bescii],3T9G_B The crystal structure of family 3 pectate lyase from Caldicellulosiruptor bescii [Caldicellulosiruptor bescii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0CJ49|PLYD_ASPTN	9.07e-70	44	250	39	243	Probable pectate lyase D OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=plyD PE=3 SV=1
sp|A1DCY5|PLYD_NEOFI	6.99e-69	44	250	26	231	Probable pectate lyase D OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=plyD PE=3 SV=1
sp|Q4WGV9|PLYD_ASPFU	7.21e-69	44	250	27	232	Probable pectate lyase D OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=plyD PE=3 SV=1
sp|B0YB89|PLYD_ASPFC	7.21e-69	44	250	27	232	Probable pectate lyase D OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=plyD PE=3 SV=1
sp|Q5B7Z3|PLYE_EMENI	7.45e-69	44	242	41	236	Pectate lyase E OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=plyE PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000543	0.999414	CS pos: 32-33. Pr: 0.5105

TMHMM  Annotations     

There is no transmembrane helices in KAF6514789.1.