CAZyme Information: KAF6514550.1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: KAF6514550.1
• CAZy Family: AA7
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
617		67208.40	5.0382

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FoxysporumFo5176	17912	660025	0	17912

• Gene Location: location=JACDXP010000015:914145-916113(-)

Full Sequence      

MSVNPSLRTVDQFTQLVFDFIVIGGGTAGLAVAARLAEADASYTVGVIEAGGPVQNDPDV
DIPGHYGRNLGGSYDWHLETLPQEGLGGRTLPWPRGKCVGGTSALNYMAWNRASRDDYDA
WEALGNQGWGWDSLLPFFKRSETFHPPSEKLQREFEISHDADTFGDSGPIHISYPTSYSP
SHALWHKTLNALGVETNPSHVGGSNVGVWTCVNAVEPSAARRSYSIDYATGSRNLHILTN
ATVDEILINQALVATGVRFTYGGVEYDVSARREVILSAGSVKSPQILELSGIGNPSVLSS
AGVSVKVESPQVGENLQEHIMLATIFEVDPSLANRDDLMRDEKLSAAAKEEYTTKADGPL
TVLPVSLCYVPFAHFVPKNTLASLYEDADKVSVFDSDKQDILRERLDGNSKLGQIEYIFD
LGNWNPNFKGEEGKKYGTMLQILQYPFSVGSIHIRPSDHATAEDSPAIDPKYYEGLHGNL
DMEAMKQCLQFVDKIVHTAPLSNIIRSSASPSTAVIKDDKRLGEWITQNTITDWHPVGTC
AMGGRAGIEGGVVDERLRVYGVHGLRVVDASVMPLQISAHIQATVYAIAEKAAHMIVEDA
RSADREGRELVTKQARL

Enzyme Prediction     

No EC number prediction in KAF6514550.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	18	599	3.3e-184	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	2.88e-102	18	605	8	542	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	3.25e-84	14	596	2	531	choline dehydrogenase; Validated
398739	GMC_oxred_C	3.58e-36	446	592	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	4.55e-33	87	319	15	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	1.06e-20	18	585	56	565	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD60932.1|AA3_2	0.0	1	617	1	617
CCT74400.1|AA3_2	0.0	1	617	1	617
QGJ00717.1|AA3_2	0.0	1	617	1	617
QGI69829.1|AA3_2	0.0	1	617	1	617
QGI87202.1|AA3_2	0.0	1	617	1	617

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4YNT_A	5.76e-81	18	603	6	571	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
6ZE2_A	3.81e-70	18	603	6	589	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
5OC1_A	1.54e-64	18	599	2	564	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	8.17e-64	18	599	3	565	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
6O9N_A	1.47e-63	18	599	36	641	Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus],6O9N_B Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A142PTM2|CITC_MONPU	3.62e-102	6	599	3	611	Dehydrogenase mpl7 OS=Monascus purpureus OX=5098 GN=mpl7 PE=1 SV=1
sp|A0A161CEV4|CITC_MONRU	3.62e-102	6	599	3	611	Dehydrogenase citC OS=Monascus ruber OX=89489 GN=citC PE=1 SV=1
sp|A0A5C1RDA6|ASC9_DIDFA	3.91e-91	9	599	5	619	Dehydrogenase OS=Didymella fabae OX=372025 GN=orf9 PE=3 SV=1
sp|A0A2H3D1U1|ARMD5_ARMGA	1.32e-87	9	599	31	632	Dehydrogenase ARMGADRAFT_1018426 OS=Armillaria gallica OX=47427 GN=ARMGADRAFT_1018426 PE=1 SV=1
sp|Q5GMY3|GMCH_MALSM	2.17e-82	18	597	47	616	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.973686	0.026317

TMHMM  Annotations     

There is no transmembrane helices in KAF6514550.1.