CAZyme Information: KAF6514413.1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: KAF6514413.1
• CAZy Family: PL1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
607	JACDXP010000015|CGC4	66231.38	8.1510

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FoxysporumFo5176	17912	660025	0	17912

• Gene Location: location=JACDXP010000015:495749-497643(+)

Full Sequence      

MHFCSIISNGLFIVGALGYRGNRVRRDVKPGGPTDPGIPSDCTYYDTWTDETSDCKAWVE
PWGISLKEFTEYNPTVKDDCSGIQVGHAYCVEVNFGSPPEDNPPKVTTTKNAEPKPEPTK
DLKPSPTQDGLIESCTSFYMAKKGDTCNKIIAHYQTFDFDDFFKWNPAVDKDCSGIWANT
WYCVGVPGTPTNLPTKTIVTTTKPTGVPKPTQTQEGIIESCTSFHMAVNGDTCAKIVSKF
GTFDFDTFYKWNPAVGKDCSGIWASYYYCVGVPGTATVRPSATTPKPTATGGIETPSPIQ
EGLVKNCNKFHQIASTTTCSSIELYYKLPLSQFLAWNPAVGKDCSSLWKGYWVCVSVEGY
KPSTTTKVTSTTQVPANGIQTPSPIQNGMVKNCEKFHQIKSTTTCTSIESYYNLPLATFL
SWNPAVGKDCTSLLVNYWVCVATVGWKPPTKTTTKAATTTQGSSNGVKTPPPVQEGMVSN
CNKFHMVQKTTTCASIQDYYKISLTDFVKWNPAVGKDCKGLWAGYNVCIGVIGGTPTKPG
NGVETPSPIQTGMVSNCKKFHMVQSTTTCASIQTYYKITLAQLTKWNPAIGSKCTALWAK
YWVCVGV

Enzyme Prediction     

EC	-	-

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
212030	LysM	2.79e-06	559	603	1	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
212030	LysM	2.46e-05	483	527	1	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
212030	LysM	1.71e-04	309	353	1	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
197609	LysM	4.12e-04	484	529	1	44	Lysin motif.
197609	LysM	0.006	138	172	1	34	Lysin motif.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QPC57789.1|CBM50	0.0	1	607	1	603
QKD59082.1|CBM50	0.0	1	607	1	599
QKD61254.1|CBM50	0.0	1	607	1	599
QGI87027.1|CBM50	0.0	1	607	1	661
QGI69682.1|CBM50	0.0	1	607	1	686

PDB Hits     

KAF6514413.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4ALG0|LYSM1_ARTBC	1.11e-102	252	606	98	456	LysM domain-containing protein ARB_05157 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_05157 PE=1 SV=1
sp|D4AVW3|LYSM5_ARTBC	2.62e-17	186	438	232	527	LysM domain-containing protein ARB_00327 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_00327 PE=3 SV=2
sp|D4B4P8|LYSM2_ARTBC	5.25e-17	135	274	29	183	LysM domain-containing protein ARB_03438 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_03438 PE=3 SV=1
sp|D4AZ68|LYSM3_ARTBC	1.28e-12	382	531	256	408	LysM domain-containing protein ARB_01488 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01488 PE=3 SV=1
sp|D4B5F9|PGDA_ARTBC	1.02e-10	474	531	380	437	Probable peptidoglycan-N-acetylglucosamine deacetylase ARB_03699 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_03699 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.944455	0.055562

TMHMM  Annotations     

There is no transmembrane helices in KAF6514413.1.