CAZyme Information: KAF6514326.1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: KAF6514326.1
• CAZy Family: AA7
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
310	JACDXP010000015|CGC18	34361.61	4.3518

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FoxysporumFo5176	17912	660025	0	17912

• Gene Location: location=JACDXP010000015:108403-109389(-)

Full Sequence      

MSGAKVILADGSMVFCSAQENSELFWALQGAGSSFGIVVEFQFNTFKAPEYVTPFTIELP
WNQKAAFEALSALQDFALVAPQAFNMFSFVTATSQVIQGLYFGDQDGLSEGLQPLLTRLE
TTVSYMKTVGWLEGLEHYADGEPLDSPAPYNAHGTFYTSSLTTPPLTREHIDSLTSTMFR
NINETSARHSWDIFFEMHGGPNSVVSQVNSSATAYVHRDKVILWQLSDMGAHGSLPRESF
AVLKDLMDSVTNSLAPEQWGMYANFIDTELDGKTAQDLYWGENLPRLKAIKAKFDPSDFF
WNPQGITLIA

Enzyme Prediction     

EC	1.1.3.-:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA7	3	306	9.6e-31	0.7030567685589519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
369658	BBE	3.43e-13	262	306	2	44	Berberine and berberine like. This domain is found in the berberine bridge and berberine bridge- like enzymes which are involved in the biosynthesis of numerous isoquinoline alkaloids. They catalyze the transformation of the N-methyl group of (S)-reticuline into the C-8 berberine bridge carbon of (S)-scoulerine.
223354	GlcD	1.15e-06	3	309	156	459	FAD/FMN-containing dehydrogenase [Energy production and conversion].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QPH04356.1|AA7	4.17e-111	3	306	244	547
ANH22765.1|AA7	2.87e-103	3	306	244	549
UPK94696.1|AA7	8.05e-103	3	306	186	489
CZS82747.1|AA7	8.29e-97	3	306	192	501
QPC71823.1|AA7	1.66e-96	3	306	192	501

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YJO_A	1.43e-97	3	306	192	501	Chain A, FAD-binding PCMH-type domain-containing protein [Fusarium graminearum PH-1]
6Y0R_AAA	2.34e-71	1	306	182	488	Chain AAA, Chitooligosaccharide oxidase [Fusarium graminearum PH-1]
5K8E_A	1.22e-64	1	306	183	492	Xylooligosaccharide oxidase from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],5L6F_A Xylooligosaccharide oxidase from Myceliophthora thermophila C1 in complex with Xylobiose [Thermothelomyces thermophilus ATCC 42464],5L6G_A Xylooligosaccharide oxidase from Myceliophthora thermophila C1 in complex with Xylose [Thermothelomyces thermophilus ATCC 42464]
3HSU_A	1.61e-62	3	310	166	480	Chain A, Glucooligosaccharide oxidase [Sarocladium strictum]
1ZR6_A	1.61e-62	3	310	166	480	The crystal structure of an Acremonium strictum glucooligosaccharide oxidase reveals a novel flavinylation [Sarocladium strictum],2AXR_A Crystal structure of glucooligosaccharide oxidase from Acremonium strictum: a novel flavinylation of 6-S-cysteinyl, 8alpha-N1-histidyl FAD [Sarocladium strictum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|I1S2K2|CHITO_GIBZE	1.20e-70	1	306	182	488	Chitooligosaccharide oxidase OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=chitO PE=1 SV=1
sp|P9WEY2|DPMAF_METAN	5.03e-70	1	310	184	493	FAD-linked oxidoreductase dpmaF OS=Metarhizium anisopliae OX=5530 GN=dpmaF PE=1 SV=1
sp|E9F5F1|SUBF_METRA	3.27e-67	1	310	184	493	FAD-linked oxidoreductase subF OS=Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) OX=655844 GN=subF PE=3 SV=1
sp|G2QG48|XYLO_MYCTT	6.25e-64	1	306	183	492	Xylooligosaccharide oxidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=xylO PE=1 SV=1
sp|Q6PW77|GOOX_SARSR	7.61e-62	3	310	185	499	Glucooligosaccharide oxidase OS=Sarocladium strictum OX=5046 GN=gluO PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000042	0.000000

TMHMM  Annotations     

There is no transmembrane helices in KAF6514326.1.