CAZyme Information: KAF6513399.1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: KAF6513399.1
• CAZy Family: AA2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
262		28377.51	9.3567

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FoxysporumFo5176	17912	660025	0	17912

• Gene Location: location=JACDXP010000017:466995-467901(-)

Full Sequence      

MKPTQALIALAAIVYAAPVVEQTKALAPPLAELDTHFEHHIKRCGKDEPTFLGRFPFANE
TYNQLTDGTPCRNVTMIYARGSRQAGNVGKANNTGPALFNSLADRIGLENLAVQGVTYKA
RRRDYIFKGGCNEGSKTMARLINQAASQCPDTKIVIAGYSQGAQLLHKAAKNVTAGVTQH
IAAAVTLGYPEKPMGKIAASRSLSVCRPGDSFCDKTIPWKPFVPFVGAPLWWFLTMLDTH
GDYNENATAVANWIADRVTNIG

Enzyme Prediction     

No EC number prediction in KAF6513399.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE5	70	257	6e-36	0.9894179894179894

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395860	Cutinase	6.05e-42	70	214	1	146	Cutinase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD62814.1|CE5	5.07e-187	1	262	1	262
CEI39834.1|CE5	2.32e-72	1	258	1	251
CZS73725.1|CE5	3.80e-70	1	257	1	246
QGI71007.1|CE5	5.14e-70	1	183	1	180
QGI88341.1|CE5	5.14e-70	1	183	1	180

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4PSC_A	1.93e-26	66	214	74	220	Structure of cutinase from Trichoderma reesei in its native form. [Trichoderma reesei QM6a],4PSD_A Structure of Trichoderma reesei cutinase native form. [Trichoderma reesei QM6a],4PSE_A Trichoderma reesei cutinase in complex with a C11Y4 phosphonate inhibitor [Trichoderma reesei QM6a],4PSE_B Trichoderma reesei cutinase in complex with a C11Y4 phosphonate inhibitor [Trichoderma reesei QM6a]
1FFD_A	2.71e-17	61	217	19	182	Chain A, CUTINASE [Fusarium vanettenii]
1FFC_A	7.20e-17	61	217	19	182	Chain A, CUTINASE [Fusarium vanettenii]
1AGY_A	7.67e-17	61	217	5	168	The 1.15 angstrom refined structure of fusarium solani pisi cutinase [Fusarium vanettenii]
5AJH_A	8.91e-17	45	217	5	184	Crystal structure of Fusarium oxysporum cutinase [Fusarium oxysporum f. sp. raphani 54005],5AJH_B Crystal structure of Fusarium oxysporum cutinase [Fusarium oxysporum f. sp. raphani 54005],5AJH_C Crystal structure of Fusarium oxysporum cutinase [Fusarium oxysporum f. sp. raphani 54005]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8X1P1|CUTI_BLUHO	7.00e-39	58	258	55	236	Cutinase OS=Blumeria hordei OX=2867405 GN=CUT1 PE=3 SV=1
sp|G4MZV6|CUTI2_MAGO7	1.34e-32	61	258	31	214	Cutinase CUT2 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) OX=242507 GN=CUT2 PE=1 SV=1
sp|Q00298|CUTI_BOTFU	3.04e-26	71	214	31	173	Cutinase OS=Botryotinia fuckeliana OX=40559 GN=cutA PE=1 SV=1
sp|G0RH85|CUTI1_HYPJQ	8.75e-26	66	214	74	220	Cutinase OS=Hypocrea jecorina (strain QM6a) OX=431241 GN=TRIREDRAFT_60489 PE=3 SV=2
sp|A0A024SC78|CUTI1_HYPJR	8.75e-26	66	214	74	220	Cutinase OS=Hypocrea jecorina (strain ATCC 56765 / BCRC 32924 / NRRL 11460 / Rut C-30) OX=1344414 GN=M419DRAFT_76732 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000219	0.999746	CS pos: 16-17. Pr: 0.9251

TMHMM  Annotations     

There is no transmembrane helices in KAF6513399.1.