CAZyme Information: KAF6513226.1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: KAF6513226.1
• CAZy Family: AA12
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
358		40036.21	8.4188

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FoxysporumFo5176	17912	660025	0	17912

• Gene Location: location=CM024374:1301925-1303112(+)

Full Sequence      

MGSVIQQLSRRATRVTARKAFTISPHHAFCQGRRYYSSEPNQKSSSAWVWLTGAGTAVGV
GFYFKSRGATPSISHVFIPTNEDYQKVYNEVAALLEEKDDYDDGSYGPVLLRLAWHASGT
YDKDTGTGGSNGATMRFAPESGYGANAGLVAARDFLEPVKAKFPWISYSDLWILAGVCAI
QEMQGPIIPYRPGRSDREAAACAPDGRLPNATKGAAHLREIFGRMGFNDQEIVALSGAHA
LGRCHTDRTGFTGPWTFSPTVLTNDFYRLLIGEEWQWKKWDGPAQYEDKATKTLMMLPTD
MVLIQDKKFRPYVEMYAKDNNAFFRDFSAVILRLFELGVPFARGTENQRWTFKPTWDS

Enzyme Prediction     

No EC number prediction in KAF6513226.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA2	99	339	2e-59	0.9411764705882353

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
173825	ascorbate_peroxidase	1.52e-148	82	342	11	253	Ascorbate peroxidases and cytochrome C peroxidases. Ascorbate peroxidases are a subgroup of heme-dependent peroxidases of the plant superfamily that share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Along with related catalase-peroxidases, ascorbate peroxidases belong to class I of the plant superfamily. Ascorbate peroxidases are found in the chloroplasts and/or cytosol of algae and plants, where they have been shown to control the concentration of lethal hydrogen peroxide molecules. The yeast cytochrome c peroxidase is a divergent member of the family; it forms a complex with cytochrome c to catalyze the reduction of hydrogen peroxide to water.
178218	PLN02608	5.27e-86	85	338	15	243	L-ascorbate peroxidase
178467	PLN02879	6.04e-71	107	338	34	246	L-ascorbate peroxidase
166005	PLN02364	2.07e-69	79	338	6	246	L-ascorbate peroxidase 1
223453	KatG	2.63e-64	82	328	68	406	Catalase (peroxidase I) [Inorganic ion transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK98426.1|AA2	1.45e-211	1	358	1	357
QGI58483.1|AA2	2.38e-208	1	355	1	355
QGI89392.1|AA2	2.38e-208	1	355	1	355
CZS76611.1|AA2	3.38e-208	1	355	1	355
QPC66997.1|AA2	4.79e-208	1	355	1	355

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4A71_A	2.97e-83	82	343	19	280	cytochrome c peroxidase in complex with phenol [Saccharomyces cerevisiae]
2V2E_A	5.57e-83	82	343	17	278	Structure of isoniazid (INH) bound to cytochrome c peroxidase mutant N184R Y36A [Saccharomyces cerevisiae]
2V23_A	5.94e-83	82	343	19	280	Structure of cytochrome c peroxidase mutant N184R Y36A [Saccharomyces cerevisiae],4A6Z_A Cytochrome c peroxidase with bound guaiacol [Saccharomyces cerevisiae]
3M23_A	7.17e-83	82	343	14	275	Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M25_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M26_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M27_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M28_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M29_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M2A_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M2B_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M2C_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M2D_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M2E_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M2F_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M2G_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M2H_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M2I_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae]
5EJT_A	7.89e-83	82	343	17	278	Thermally annealed ferryl Cytochrome C Peroxidase crystal structure [Saccharomyces cerevisiae S288C],5EJX_A X-ray Free Electron Laser Structure of Cytochrome C Peroxidase [Saccharomyces cerevisiae S288C]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4ING3|CCPR_GIBZE	6.00e-209	1	355	1	355	Cytochrome c peroxidase, mitochondrial OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=CCP1 PE=3 SV=1
sp|Q7SDV9|CCPR_NEUCR	4.98e-180	11	353	12	354	Cytochrome c peroxidase, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=ccp-1 PE=3 SV=1
sp|A4QVH4|CCPR_MAGO7	7.35e-176	1	355	1	360	Cytochrome c peroxidase, mitochondrial OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) OX=242507 GN=CCP1 PE=3 SV=1
sp|Q4WPF8|CCPR_ASPFU	2.81e-155	32	353	42	363	Cytochrome c peroxidase, mitochondrial OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=ccp1 PE=3 SV=1
sp|P0C0V3|CCPR_EMENI	7.80e-154	1	353	1	358	Cytochrome c peroxidase, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ccp1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999919	0.000101

TMHMM  Annotations     

There is no transmembrane helices in KAF6513226.1.