CAZyme Information: KAF6512829.1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: KAF6512829.1
• CAZy Family: AA1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
485		52115.48	6.4244

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FoxysporumFo5176	17912	660025	0	17912

• Gene Location: location=JACDXP010000019:581567-583024(+)

Full Sequence      

MGPFACSLTALNLLGCISPAFVAAVPMDSYSGSEVLISVNGHVKHQELDGFGASQAFQRA
EDILGKDGLSKEGTQHVLDLLFSKDIGAGFSILRNGIGSSNSSEKNFMNSIEPFSPGSPG
AKPHYVWDGYDSGQLTVAREAFKRGLKFLYGNAWSAPGYMKTNQDENNGGYLCGVTGATC
ASGDWKQAYADYLLQWVDFYRKSGVKVTNLGFLNEPQFAAPYAGMLSNGTQAADFVRVLG
KTIQKRGIHDLTIACCDGEGWDLQEDMMAGLTAGPDPAINYLGVVSGHGYVSPPNHSLST
TKKTWLTEWADLTGQFTPYTFYNNSSQGEGMTWAGRIQTALVDANVSGFLYWIGAENSTT
NSALINMIGDKVIPSKRFWAFASFSRFARPGARRIEATSSVPLITVSAFLNTDGTVATQV
LNNDTVAHHVRLVVSGTGRSPHSLKPFLTDNSNDLTALEHLNAAGKGSFQTTIPPRSLVS
FITDS

Enzyme Prediction     

EC	3.2.1.8:3	3.2.1.-:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH30	36	481	4.2e-184	0.9887133182844243

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227807	XynC	1.63e-24	20	484	14	429	O-Glycosyl hydrolase [Cell wall/membrane/envelope biogenesis].
396577	Glyco_hydro_59	3.12e-11	77	355	27	256	Glycosyl hydrolase family 59.
405300	Glyco_hydr_30_2	1.20e-09	34	353	1	354	O-Glycosyl hydrolase family 30.
407314	Glyco_hydro_30C	1.70e-06	391	446	1	57	Glycosyl hydrolase family 30 beta sandwich domain.
307945	Glyco_hydro_30	4.02e-06	50	216	3	158	Glycosyl hydrolase family 30 TIM-barrel domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD62253.1|GH30_7	0.0	1	485	1	485
CCT73045.1|GH30_7	0.0	1	485	1	485
QGI99540.1|GH30_7	0.0	1	485	1	485
QGI68650.1|GH30_7	0.0	1	485	1	485
QGI85842.1|GH30_7	0.0	1	485	1	485

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6IUJ_A	3.84e-191	23	484	11	472	Chain A, GH30 Xylanase B [Talaromyces cellulolyticus CF-2612],6IUJ_B Chain B, GH30 Xylanase B [Talaromyces cellulolyticus CF-2612]
6KRL_A	4.48e-190	34	484	92	543	Crystal structure of GH30 xylanase B from Talaromyces cellulolyticus expressed by Pichia pastoris [Saccharomyces uvarum],6KRN_A Crystal structure of GH30 xylanase B from Talaromyces cellulolyticus expressed by Pichia pastoris in complex with aldotriuronic acid [Saccharomyces uvarum]
7O0E_A	7.56e-124	37	482	5	446	Chain A, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464],7O0E_G Chain G, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464]
7NCX_AAA	1.56e-122	37	482	12	453	Chain AAA, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464]
6M5Z_A	2.22e-100	24	482	12	452	Chain A, GH30 Xylanase C [Talaromyces cellulolyticus CF-2612],6M5Z_B Chain B, GH30 Xylanase C [Talaromyces cellulolyticus CF-2612]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|G2Q1N4|XY30A_MYCTT	5.38e-124	11	482	5	470	GH30 family xylanase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Xyn30A PE=1 SV=1
sp|Q6YK37|XYNC_BACIU	2.60e-09	134	482	98	420	Glucuronoxylanase XynC OS=Bacillus subtilis OX=1423 GN=xynC PE=3 SV=2
sp|O16580|GLCM1_CAEEL	4.27e-09	149	434	193	493	Putative glucosylceramidase 1 OS=Caenorhabditis elegans OX=6239 GN=gba-1 PE=1 SV=2
sp|Q45070|XYNC_BACSU	1.88e-08	134	484	97	421	Glucuronoxylanase XynC OS=Bacillus subtilis (strain 168) OX=224308 GN=xynC PE=1 SV=1
sp|O16581|GLCM2_CAEEL	3.49e-06	140	427	185	484	Putative glucosylceramidase 2 OS=Caenorhabditis elegans OX=6239 GN=gba-2 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.001086	0.998892	CS pos: 15-16. Pr: 0.3523

TMHMM  Annotations     

There is no transmembrane helices in KAF6512829.1.