CAZyme Information: KAF6512790.1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: KAF6512790.1
• CAZy Family: PL1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
407		44669.71	7.4119

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FoxysporumFo5176	17912	660025	0	17912

• Gene Location: location=JACDXP010000019:446128-447501(+)

Full Sequence      

MRASTISAIFSGLAVSITAQSDLDGSVWKALLAEPQSKRGFSDMPRNRPVKRQSGWNPPA
DLKAPLQEVWEHYEKTYDGGLDANVNTGFHQIMANKGYLNICVRWDSSAAITEAQRTKIA
SAYNAQYQKWFKWLYGYNGFPYDDVKVNIVAYAVKDKSQLQGSTAGYEVYTELDADGVPM
CPVACARDAHLDGDYSGCKAGADRHYDHSLWLKDGLEGGFGHNWGQEVGREYFMNNLDSD
SIHILLHEMGHTFALDDFYDWTPTGVTKFIMLAGASMEITDFDGWMYRNWWYYLSQKNNW
SSSKSSSNAAPVSSESKPSVNTAAPVKAPTKTASPKPSTSTTKATVAKPTSTKKATATKV
PSTEKSSGAEAAAWGQCGGNNWTGATKCASGTKCTKHNDYYSQCVAN

Enzyme Prediction     

No EC number prediction in KAF6512790.1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395595	CBM_1	1.99e-13	373	401	1	29	Fungal cellulose binding domain.
197593	fCBD	3.55e-13	372	405	1	34	Fungal-type cellulose-binding domain. Small four-cysteine cellulose-binding domain of fungi
398885	BASP1	5.99e-05	309	366	178	234	Brain acid soluble protein 1 (BASP1 protein). This family consists of several brain acid soluble protein 1 (BASP1) or neuronal axonal membrane protein NAP-22. The BASP1 is a neuron enriched Ca(2+)-dependent calmodulin-binding protein of unknown function.
236792	PRK10905	4.51e-04	317	395	167	249	cell division protein DamX; Validated
236792	PRK10905	0.002	309	368	178	235	cell division protein DamX; Validated

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD62209.1|CBM1	4.80e-290	1	407	1	407
CCT73102.1|CBM1	7.52e-253	1	407	1	408
QGI99522.1|CBM1	1.82e-248	1	407	1	406
QGI85823.1|CBM1	1.82e-248	1	407	1	406
QGI68632.1|CBM1	1.82e-248	1	407	1	406

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6Q8M_A	7.79e-09	368	405	369	406	GH10 endo-xylanase [Aspergillus aculeatus ATCC 16872],6Q8M_B GH10 endo-xylanase [Aspergillus aculeatus ATCC 16872],6Q8N_A GH10 endo-xylanase in complex with xylobiose epoxide inhibitor [Aspergillus aculeatus ATCC 16872],6Q8N_B GH10 endo-xylanase in complex with xylobiose epoxide inhibitor [Aspergillus aculeatus ATCC 16872]
6RV8_A	3.39e-06	369	405	3	39	Crystal Structure of Glucuronoyl Esterase from Cerrena unicolor covalent complex with the aldouronic acid UXXR [Cerrena unicolor],6RV8_B Crystal Structure of Glucuronoyl Esterase from Cerrena unicolor covalent complex with the aldouronic acid UXXR [Cerrena unicolor]
5X39_A	7.22e-06	371	405	2	36	Chain A, Exoglucanase 1 [Trichoderma reesei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P49075|GUX3_AGABI	1.07e-09	369	407	20	58	Exoglucanase 3 OS=Agaricus bisporus OX=5341 GN=cel3 PE=1 SV=1
sp|P46239|GUNF_FUSOX	1.62e-09	369	405	17	53	Putative endoglucanase type F OS=Fusarium oxysporum OX=5507 PE=2 SV=1
sp|P0CT87|GCE1_PHACR	1.08e-07	369	405	20	56	4-O-methyl-glucuronoyl methylesterase 1 OS=Phanerochaete chrysosporium (strain RP-78 / ATCC MYA-4764 / FGSC 9002) OX=273507 GN=e_gw1.18.61.1 PE=1 SV=1
sp|Q8WZJ4|XYNA_TALFU	1.16e-07	371	405	495	529	1,4-beta-D-glucan cellobiohydrolase xynA OS=Talaromyces funiculosus OX=28572 GN=xynA PE=1 SV=1
sp|I1S3C6|XYND_GIBZE	1.56e-07	369	405	16	52	Endo-1,4-beta-xylanase D OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=XYLD PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.888516	0.111496

TMHMM  Annotations     

There is no transmembrane helices in KAF6512790.1.