CAZyme Information: KAF5691963.1

Basic Information

• Species: Fusarium circinatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium circinatum
• CAZyme ID: KAF5691963.1
• CAZy Family: PL1
• CAZyme Description: ankyrin repeat domain-containing protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1729		193196.72	6.0832

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FcircinatumNRRL25331	13905	N/A	0	13905

• Gene Location: location=JAAQPE010000010:2699-8963(-)

Full Sequence      

MRGFVEQYENDFLERYDSLLTPVERSDVFRILVCKHFGGIYADLDTELIRHPAAWISGSD
IATWTDPKTGKAHGYYNTSGTPDYETPVVSLLWGLEADNDPESDAYWRRSYTYPQQLSQW
AFAAAPQHPVFERYMDNLRTYTRDNETAAQNSDPLKRTGPAAVTLATKSWLEDNVDFRWT
SLTGVKDGGKSKLIEDILILPITGFQYRKKTEMAEVLGIVSGAAGLLSLAIEVTKLSYTY
IASVRGAPKSLTSYIGELATLTSVLLQLEDLIQAKRFNGQNIQTLSKALHDCRLEVEHLK
AKLEKKLSYGRIKARVAALAWPLSESELLEKVNMLHRYNGIFSSALQADTLTVTIATNKE
LRDIRQSTEAKEIITWYKWDVAIEASTSHLDDYCPSTWQTFLSGSFYQSWRSGSTPVVWG
YGQPGAGKTVLAALVLRHVKSGNLPGTAIASHFFSSSRPKETVGNFLRSLIAQALNGCPV
IPQEASALYEKGSQNVMLTDLVSVLGAIAKSMTTCIILDALDECPFLPKLFNILSTLQDL
GVRIFATARDLPKIRKHFEKRPRVEISATRQDLDFYVNHRLEHGEVAFESIGIELKSELV
SAIVKRVAGSFLLARLIMDHVTSLLTIKDIRKALVSLPANYNEAYLSTFDRIVKQTPSLR
DLALKSLNFISYVKEPLRMVELQHALTTEEGMLEVDPEDLHPSKAIISSCLGLLVVSGPE
KIVEFVHSTARDFLQSRPEGMDKRPHLTIVRSCISYMSTDEMSQGRCLSHEDVIQRCQKQ
PFLHYAANFYGYHAQVVEDECSHQLSRFLENDALRDSSWQLLNFEAHLDTSVSESMFDSS
PRNVLALHVAAFWGFKSYIERSLSYTQQGTAGAQKQNLNKHDSHGWTPLHWAVSMGHESI
VEILLRSGASPDLPDLAGWTPTFWAAFKGYADIIEMLWRYDTAPFRCDVKGLTPLHWAVS
AGQTEIVKRLLNLKTRFAQYEKSSVLSLPSLDDLTVERARAMTTMANESPFKFYSEGTDI
EMFSAIFNALKQSFREKEDRPRERGEGYYTFDPFLYGPFGQSLKADYGRRARPDRDYQRG
KPDVGFLEFVDKLLIHATRSEDLPIIKLAFDLKLVKTSGIDSLGLLHEAAASGWVEGMAT
LIDLGADVNNAERSFKQTPLHKACQNQRQEAVKLLLGIDEIDTNAQASDGKTPIMFLMTA
SYEEKGADLYELLVSRGASISMQDTEGNSLMHYALRTCNTTIVQLLCTAGLSIESPNKSG
QLPLHWMAHWKYFDLRKPVTLDEVHDVRKKRRDCMKLVFQLSSLSSLDSVCDWENGATPS
RQTPLSLALKSHNWDIAAELLKHIKEPVNMRYLLDPYHSIVNELCMVSERLATVSAPGSR
DRTMLYYELQPLPSDDWTRILEMLLHAGADINETGWDKNTPLQLCVQRAASISVIDTLLK
RGASPYQAGKDGLDCFQLALMSCDEAGSWDIMHCLRTYANTHPDPSHYFCQGGFLIAAET
PIDNEQTRYLQVLRQTNAINCETRSGRTLIYEAASRGNTHLVQRLLEHDAYACYVDDFGS
SVLHAAAKKQAPATVAVLLEAGADVHQASMDEHSSTVTGTPLHVCLEACNGGEIKSETVE
TVRILLSYGADPNYAAVKDGHTETILSLTLKPLCQSIYYPNLDAIPSEDSDHLLLEVLKL
LIGAGARVAESADDIIVGVVAKMEGHESLWEEMRSQLVPRSHAPNLGAE

Enzyme Prediction     

No EC number prediction in KAF5691963.1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
293786	ANK	5.79e-26	884	971	1	88	ankyrin repeats. Ankyrin repeats are one of the most abundant repeat motifs, and generally function as scaffolds for protein-protein interactions in processes including cell cycle, transcriptional regulation, signal transduction, vesicular trafficking, and inflammatory response. Although predominantly found in eukaryotic proteins, they are also found in some bacterial and viral proteins. Less is known of their physiological roles in prokaryotes. Some bacterial ANK proteins play key roles in microbial pathogenesis by mimicking or manipulating host function(s). The pathogen Providencia alcalifaciens N-formyltransferase ankyrin repeats function in small molecule binding and allosteric control. Ankyrin-repeat proteins have been associated with a number of human diseases.
293786	ANK	3.45e-20	846	937	5	87	ankyrin repeats. Ankyrin repeats are one of the most abundant repeat motifs, and generally function as scaffolds for protein-protein interactions in processes including cell cycle, transcriptional regulation, signal transduction, vesicular trafficking, and inflammatory response. Although predominantly found in eukaryotic proteins, they are also found in some bacterial and viral proteins. Less is known of their physiological roles in prokaryotes. Some bacterial ANK proteins play key roles in microbial pathogenesis by mimicking or manipulating host function(s). The pathogen Providencia alcalifaciens N-formyltransferase ankyrin repeats function in small molecule binding and allosteric control. Ankyrin-repeat proteins have been associated with a number of human diseases.
403870	Ank_2	5.43e-18	889	971	1	81	Ankyrin repeats (3 copies).
293786	ANK	1.63e-17	1525	1633	1	95	ankyrin repeats. Ankyrin repeats are one of the most abundant repeat motifs, and generally function as scaffolds for protein-protein interactions in processes including cell cycle, transcriptional regulation, signal transduction, vesicular trafficking, and inflammatory response. Although predominantly found in eukaryotic proteins, they are also found in some bacterial and viral proteins. Less is known of their physiological roles in prokaryotes. Some bacterial ANK proteins play key roles in microbial pathogenesis by mimicking or manipulating host function(s). The pathogen Providencia alcalifaciens N-formyltransferase ankyrin repeats function in small molecule binding and allosteric control. Ankyrin-repeat proteins have been associated with a number of human diseases.
293786	ANK	3.99e-17	1126	1224	6	98	ankyrin repeats. Ankyrin repeats are one of the most abundant repeat motifs, and generally function as scaffolds for protein-protein interactions in processes including cell cycle, transcriptional regulation, signal transduction, vesicular trafficking, and inflammatory response. Although predominantly found in eukaryotic proteins, they are also found in some bacterial and viral proteins. Less is known of their physiological roles in prokaryotes. Some bacterial ANK proteins play key roles in microbial pathogenesis by mimicking or manipulating host function(s). The pathogen Providencia alcalifaciens N-formyltransferase ankyrin repeats function in small molecule binding and allosteric control. Ankyrin-repeat proteins have been associated with a number of human diseases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGI99627.1|GT32	0.0	1	1190	1	1207
QGI68738.1|GT32	0.0	1	1190	1	1069
QGI85929.1|GT32	0.0	1	1190	1	1069
QKD59215.1|GT32	2.08e-126	1	206	83	288
CCT73207.1|GT32	7.75e-123	1	205	158	362

PDB Hits     

KAF5691963.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9Z148|EHMT2_MOUSE	2.33e-08	1176	1274	824	918	Histone-lysine N-methyltransferase EHMT2 OS=Mus musculus OX=10090 GN=Ehmt2 PE=1 SV=2
sp|Q96KQ7|EHMT2_HUMAN	6.79e-08	1176	1274	771	865	Histone-lysine N-methyltransferase EHMT2 OS=Homo sapiens OX=9606 GN=EHMT2 PE=1 SV=3
sp|A6NGH8|ANR61_HUMAN	1.69e-06	1126	1265	172	316	Ankyrin repeat domain-containing protein 61 OS=Homo sapiens OX=9606 GN=ANKRD61 PE=4 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000058	0.000000

TMHMM  Annotations     

There is no transmembrane helices in KAF5691963.1.