CAZyme Information: KAF5691371.1

Basic Information

• Species: Fusarium circinatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium circinatum
• CAZyme ID: KAF5691371.1
• CAZy Family: GT66
• CAZyme Description: oxidoreductase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
362	JAAQPE010000020|CGC1	40168.63	6.9303

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FcircinatumNRRL25331	13905	N/A	0	13905

• Gene Location: location=JAAQPE010000020:108711-109848(+)

Full Sequence      

MSGKTFKVGVVGYGMSAKIFHIPFLTQTPQFKLHAIVQRSPKDGNSAPSDYPDIKHYTDY
KDLFADSAVDLVVISTPPNNHFELTKAALEAGKHVLTEKPFVPTSAEADKLIEIAKKNGK
LLIVYQNRRWDADFVTLKKIISEGTLGRIVQFDNHFDRYRLVPSKNWKLDLPLSQGGSAL
YDLGTHLIDQAYVLFGKPQSVHGRLLSQREGKFDFENPDGVSAELTYPDGLLVNIRISVL
SAELEQPRFWVRGTKGSFRKLGLDTQEDALKAGAKATDADFGKEDPARYKLVVVDDNEKA
KEQTISSIETPTYKAFYAQLGKAVESGKEEDVPVKASEARDVLQIIEGVFESAKTGKDVT
FA

Enzyme Prediction     

No EC number prediction in KAF5691371.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	5	152	4.2e-21	0.38847117794486213

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
183212	PRK11579	5.05e-99	1	362	1	346	putative oxidoreductase; Provisional
223745	MviM	2.18e-76	3	359	1	338	Predicted dehydrogenase [General function prediction only].
182305	PRK10206	1.66e-67	5	353	1	335	putative oxidoreductase; Provisional
396129	GFO_IDH_MocA	2.88e-32	6	125	1	119	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.
275173	myo_inos_iolG	1.93e-24	5	152	1	148	inositol 2-dehydrogenase. All members of the seed alignment for this model are known or predicted inositol 2-dehydrogenase sequences co-clustered with other enzymes for catabolism of myo-inositol or closely related compounds. Inositol 2-dehydrogenase catalyzes the first step in inositol catabolism. Members of this family may vary somewhat in their ranges of acceptable substrates and some may act on analogs to myo-inositol rather than myo-inositol per se. [Energy metabolism, Sugars]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QAT16263.1|GH13|GH133|GH23|GT2|GT4|GT5	2.89e-13	62	197	37864	37989
CCO12039.2|GT4	8.53e-12	8	202	4	199
BBH22343.1|GH109	2.21e-11	1	156	1	155
BBI33503.1|GH109	2.23e-11	49	270	48	296
BBI35897.1|GH109	3.93e-11	52	278	52	303

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3KUX_A	1.20e-71	7	347	9	334	Structure of the YPO2259 putative oxidoreductase from Yersinia pestis [Yersinia pestis]
3FHL_A	9.97e-70	1	359	1	351	Crystal structure of a putative oxidoreductase from bacteroides fragilis nctc 9343 [Bacteroides fragilis NCTC 9343],3FHL_B Crystal structure of a putative oxidoreductase from bacteroides fragilis nctc 9343 [Bacteroides fragilis NCTC 9343],3FHL_C Crystal structure of a putative oxidoreductase from bacteroides fragilis nctc 9343 [Bacteroides fragilis NCTC 9343],3FHL_D Crystal structure of a putative oxidoreductase from bacteroides fragilis nctc 9343 [Bacteroides fragilis NCTC 9343]
3GDO_A	2.77e-68	1	359	1	346	Crystal structure of putative oxidoreductase yvaA from Bacillus subtilis [Bacillus subtilis subsp. subtilis str. 168],3GDO_B Crystal structure of putative oxidoreductase yvaA from Bacillus subtilis [Bacillus subtilis subsp. subtilis str. 168]
3GFG_A	1.41e-67	5	359	14	355	Structure of putative oxidoreductase yvaA from Bacillus subtilis in triclinic form [Bacillus subtilis subsp. subtilis str. 168],3GFG_B Structure of putative oxidoreductase yvaA from Bacillus subtilis in triclinic form [Bacillus subtilis subsp. subtilis str. 168],3GFG_C Structure of putative oxidoreductase yvaA from Bacillus subtilis in triclinic form [Bacillus subtilis subsp. subtilis str. 168],3GFG_D Structure of putative oxidoreductase yvaA from Bacillus subtilis in triclinic form [Bacillus subtilis subsp. subtilis str. 168],3GFG_E Structure of putative oxidoreductase yvaA from Bacillus subtilis in triclinic form [Bacillus subtilis subsp. subtilis str. 168],3GFG_F Structure of putative oxidoreductase yvaA from Bacillus subtilis in triclinic form [Bacillus subtilis subsp. subtilis str. 168],3GFG_G Structure of putative oxidoreductase yvaA from Bacillus subtilis in triclinic form [Bacillus subtilis subsp. subtilis str. 168],3GFG_H Structure of putative oxidoreductase yvaA from Bacillus subtilis in triclinic form [Bacillus subtilis subsp. subtilis str. 168],3GFG_I Structure of putative oxidoreductase yvaA from Bacillus subtilis in triclinic form [Bacillus subtilis subsp. subtilis str. 168],3GFG_J Structure of putative oxidoreductase yvaA from Bacillus subtilis in triclinic form [Bacillus subtilis subsp. subtilis str. 168],3GFG_K Structure of putative oxidoreductase yvaA from Bacillus subtilis in triclinic form [Bacillus subtilis subsp. subtilis str. 168],3GFG_L Structure of putative oxidoreductase yvaA from Bacillus subtilis in triclinic form [Bacillus subtilis subsp. subtilis str. 168]
3E82_A	2.55e-56	1	356	3	340	Crystal structure of a putative oxidoreductase from Klebsiella pneumoniae [Micrococcus luteus NCTC 2665],3E82_B Crystal structure of a putative oxidoreductase from Klebsiella pneumoniae [Micrococcus luteus NCTC 2665],3E82_D Crystal structure of a putative oxidoreductase from Klebsiella pneumoniae [Micrococcus luteus NCTC 2665],3E82_E Crystal structure of a putative oxidoreductase from Klebsiella pneumoniae [Micrococcus luteus NCTC 2665]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O42896|YBQ3_SCHPO	5.02e-74	7	359	5	366	Uncharacterized oxidoreductase C115.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC115.03 PE=3 SV=1
sp|O13991|YEG9_SCHPO	1.62e-72	7	359	5	365	Uncharacterized oxidoreductase C26H5.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC26H5.09c PE=2 SV=3
sp|P77376|YDGJ_ECOLI	2.92e-70	7	354	6	338	Uncharacterized oxidoreductase YdgJ OS=Escherichia coli (strain K12) OX=83333 GN=ydgJ PE=1 SV=2
sp|O32223|IOLW_BACSU	5.64e-67	5	359	13	354	scyllo-inositol 2-dehydrogenase (NADP(+)) IolW OS=Bacillus subtilis (strain 168) OX=224308 GN=iolW PE=1 SV=1
sp|P46853|YHHX_ECOLI	5.19e-53	11	353	8	336	Uncharacterized oxidoreductase YhhX OS=Escherichia coli (strain K12) OX=83333 GN=yhhX PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000044	0.000000

TMHMM  Annotations     

There is no transmembrane helices in KAF5691371.1.