CAZyme Information: KAF5690596.1

Basic Information

• Species: Fusarium circinatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium circinatum
• CAZyme ID: KAF5690596.1
• CAZy Family: GT41
• CAZyme Description: capsular associated protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
804		91108.57	7.5536

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FcircinatumNRRL25331	13905	N/A	0	13905

• Gene Location: location=JAAQPE010000030:228970-231384(-)

Full Sequence      

MAVSSLVVFSTGTYYATSRITRSTYYCFELLESKRSTLALQCMGLVLDAIIVILLWRLLA
WSRTAKLRLRTLGTVLTLSSISMSLVWVGSRLFRGSSVLHAGFGFLYGFDIIVDSVAFAA
LVISATFWVCETSPLTPSAIITFLVGTAKACHNIFNYGDYLHPTRLDEITPLYFIAFGMI
IFTYTHGIQSVVFIRRFVLMALLVGLVVGTTVFIAKSDPQTFKRHPVNDFIYRANIRQDR
WMQEASTSGSLPVAHKIYKERHEGRDPPPAFADWYDLAKDTVVIDKFDQIDQDLAPFRAI
APNKLRQRASILSQMPGIHTIGIKDGNASRLPEVTGHDAEVLDGLVATINKFAKFLPDML
FPVNLGITPRILPSWETANGHNRADLTPIVNLISKRATKDDDEDQVKEARSAETPMAAPL
PALPDYPQTKEPSLISPADYRQMQVEACPPGSRTRTNPHWNIGEFCADCVRRHSKAQLMV
NWERSLQYCFQPDLKYLHGMSLSSPHVEPIRDLLPLFGFSKSEPFNDILIPLPQEDDDRL
DIGWNFDRRYDAMFWRGQTDNGVISDQALRGNHKFRLLHMLGNQNPEDKVSMVLPTAKDP
SLYRHEKVPITEANLVLPSSVGMNNYTGCMGPNCELLHQTYPIVNEAQDQEPLEYRYILL
LDKDYGPSPDLLRVLRSKSVPFISTIFRTWYSDRLIPWLHFVPIDTRYQGLHTTLTYFTG
TQKKAYLNGRDTDMKGLAKDGAWIAQQGAKWANQALGEKDKEVYLFRLLLEWGRLVDDKR
DEIGTSKNDKGELVSSPWTQNQKW

Enzyme Prediction     

No EC number prediction in KAF5690596.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	492	776	6.8e-47	0.98

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214773	CAP10	7.46e-06	515	775	32	252	Putative lipopolysaccharide-modifying enzyme.
271357	SLC5sbd	0.005	49	222	8	202	Solute carrier 5 family, sodium/glucose transporters and related proteins; solute-binding domain. This family represents the solute-binding domain of SLC5 proteins (also called the sodium/glucose cotransporter family or solute sodium symporter family) that co-transport Na+ with sugars, amino acids, inorganic ions or vitamins. Family members include: the human glucose (SGLT1, 2, 4, 5), chiro-inositol (SGLT5), myo-inositol (SMIT), choline (CHT), iodide (NIS), multivitamin (SMVT), and monocarboxylate (SMCT) cotransporters, as well as Vibrio parahaemolyticus glucose/galactose (vSGLT), and Escherichia coli proline (PutP) and pantothenate (PutF) cotransporters. Vibrio parahaemolyticus Na(+)/galactose cotransporter (vSGLT) has 13 transmembrane helices (TMs): TM-1, an inverted topology repeat: TMs1-5 and TMs6-10, and TMs 11-12 (TMs numbered to conform to the solute carrier 6 family Aquifex aeolicus LeuT). One member of this family, human SGLT3, has been characterized as a glucose sensor and not a transporter. Members of this family are important in human physiology and disease.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD48027.1|GT90	0.0	1	804	179	982
QGI75530.1|GT90	0.0	1	804	178	981
QGI58310.1|GT90	0.0	1	804	178	981
QGI89222.1|GT90	0.0	1	804	178	981
CCT61886.1|GT90	0.0	1	804	162	965

PDB Hits     

KAF5690596.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5K8R6|CXT1_CRYNJ	9.17e-21	248	796	173	670	Beta-1,2-xylosyltransferase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CXT1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999667	0.000361

TMHMM  Annotations     

Start	End
37	59
72	91
106	128
135	157
172	194
196	215