CAZyme Information: KAF5689707.1

Basic Information

• Species: Fusarium circinatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium circinatum
• CAZyme ID: KAF5689707.1
• CAZy Family: GT34
• CAZyme Description: beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
865	JAAQPE010000043|CGC1	98578.72	6.0049

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FcircinatumNRRL25331	13905	N/A	0	13905

• Gene Location: location=JAAQPE010000043:61984-64581(+)

Full Sequence      

MLRQIHLDKGWKFKQASSLNNGAASSFLPVAQFPTVAHIDLLHHELIPDPYIDINELKCL
WVNDADWTYRTEEISPLDLKSSDKAELVFEGLDTVVDVYLNNWHILFSNNMHRSHRIDVT
EMLRGREKPSVLELRFRAAPAYGRSERERIGYKTLKVGRGVNFGGSERLFVRKAQYHWGW
DWGPAVNTCGPWKPIYLEVYESRICDLRVTQDVAPDLCSVDIKVEAQLDGHESINEVQVQ
LLDVQTGAIVVDDKASKSTKGALSFTVKLNKPKLWYPFLYGEQNLYLLQVSIPNHTVSRK
LGIRRLRLLQHPLKDQPGTSFIFEVNNVRLFSGGSCWIPADFMLPRVSKSTYEKWITLAK
AGNQSMIRVWGGGIVESDDFYDLCDREGIMVWQDFLYACGNYPASPDFVANVKIEAEQQV
QRVGHHPSLVLWCGNNEDYMCADGDRCWDVDYSDTTGPWDKTTFPAREIYERTLPSVIKA
SGTDVPYWISSPYGGSFSNDTTVGDTHCWDVWHGKMSPYQDYKAYMSRFISEFGFESAPS
LQTLHRAITSPKERHSQSRTFDVHDKGPGHQRRYPMYMGENYRFRMNPLKDFVYCTQFLQ
AEAMAYAYNCWRREFRGPGEENCGGVLVWQLNDIWPGISWALVDVDMNPKPAYYITKRAL
HKMVVGMERVVTEKPPYITTGYLDKKHKADVWAVNGHLHEMRVNLEVKAFDIQSGKSVQW
EDAVASKEHVLKGNRSTELLSGLEIPNPDETVLVAYIRDVSSGEQLARWVSWPEPLKYVH
MASDLKVTTEVVDDGSAVIVRANAPAKGVVLSASDSDGKSLVFDNNFIDLVPEEEVRVGV
TAGLLGDRVDVRFLYDWELEPGFEL

Enzyme Prediction     

EC	3.2.1.25:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	4	722	1.3e-86	0.6688829787234043

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225789	LacZ	1.43e-69	46	677	46	647	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
407658	Mannosidase_ig	6.38e-14	688	778	2	91	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.
395572	Glyco_hydro_2	2.15e-10	203	304	2	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
407625	Ig_mannosidase	6.92e-10	784	856	3	78	Ig-fold domain. This Ig-like fold domain is found in mannosidase enzymes.
236673	ebgA	2.55e-06	89	441	132	454	cryptic beta-D-galactosidase subunit alpha; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGI79970.1|GH2	0.0	1	865	1	864
QGI62799.1|GH2	0.0	1	865	1	864
QGI93688.1|GH2	0.0	1	865	1	864
CCT66619.1|GH2	0.0	1	865	1	864
QKD50554.1|GH2	0.0	1	865	1	864

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5N6U_A	1.13e-125	5	771	27	785	Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_B Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_C Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_D Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12]
2VJX_A	5.19e-111	7	842	11	818	Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]
2JE8_A	5.43e-111	7	842	13	820	Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JE8_B Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
7OP6_A	5.56e-111	7	842	13	820	Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP6_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_A Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482]
2WBK_A	1.44e-110	7	842	11	818	Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482],2WBK_B Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|I2C092|MANBB_THETO	1.47e-235	5	854	7	852	Beta-mannosidase B OS=Thermothelomyces thermophilus OX=78579 GN=man9 PE=1 SV=1
sp|Q0CCA0|MANBB_ASPTN	1.72e-192	4	855	6	840	Beta-mannosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mndB PE=3 SV=2
sp|Q2TXB7|MANBB_ASPOR	1.57e-190	4	847	6	834	Beta-mannosidase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=mndB PE=3 SV=3
sp|B8NW36|MANBB_ASPFN	8.76e-190	4	847	6	834	Beta-mannosidase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=mndB PE=3 SV=1
sp|A2QYN2|MANBB_ASPNC	5.91e-184	4	854	6	842	Beta-mannosidase B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=mndB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000060	0.000000

TMHMM  Annotations     

There is no transmembrane helices in KAF5689707.1.