CAZyme Information: KAF5686817.1

Basic Information

• Species: Fusarium circinatum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium circinatum
• CAZyme ID: KAF5686817.1
• CAZy Family: GT1
• CAZyme Description: 6-hydroxy-D-nicotine oxidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
592		66655.13	6.5033

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FcircinatumNRRL25331	13905	N/A	0	13905

• Gene Location: location=JAAQPE010000086:36372-38150(+)

Full Sequence      

MASAQVNGFIGMQYSREGSDYEKGDYKFFNEQYATSSYVDVLDPSGKPLHDLNPAHIFRP
KDDNDVKAVIKYAVENKVGIAIKSGGHQYSGASSCGDKNVQLDLSNTYKDLKIIDKPKIN
VADDRVLVFAGVSNQLQDFLAYLTSHKLFAPTGQCAYVCLGGHGQTGGYGQLGRSFGLLG
DYIVDIRLIDHKGEVLHVNQDHNAELFNAIRGGSPGNFGVVTHYTISALKAKSYMGIENT
IKTPNSAKPKTFHGPHGIKAAWIFEEDRLKTLLTAVAEMSDQGTKARGFDLCVNVLSTDF
DIAKLFPALKDDENWKTLQNAVDGFLPDAVKALLDGKLPPLIVLYAQWCPVGDQQKYDED
VDAWFQQFRELDHLLLGRIQFDEFSADMSDMVGHWLFPKRREFPLPYVKRTYATNSKTLG
KDGWVKTLVERLKLICDPYEKLDDANEKPVKNPLYDNCKLSAQIQCFGGENSMFYNNRNN
GAAYSWRDSTVLQTVDCWYLNRDQPKYEESQKLANKWQAENDRAMIGANSCFSKTDRRVL
WGSWGEWDMAKPEVWKTYYEDEAKYQSIGKVRAAWDPHGTFTANPFAVARQS

Enzyme Prediction     

EC	1.1.3.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA7	51	237	9.5e-48	0.38427947598253276

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
223354	GlcD	1.60e-12	54	226	32	201	FAD/FMN-containing dehydrogenase [Energy production and conversion].
396238	FAD_binding_4	2.17e-12	54	199	1	139	FAD binding domain. This family consists of various enzymes that use FAD as a co-factor, most of the enzymes are similar to oxygen oxidoreductase. One of the enzymes Vanillyl-alcohol oxidase (VAO) has a solved structure, the alignment includes the FAD binding site, called the PP-loop, between residues 99-110. The FAD molecule is covalently bound in the known structure, however the residue that links to the FAD is not in the alignment. VAO catalyzes the oxidation of a wide variety of substrates, ranging form aromatic amines to 4-alkylphenols. Other members of this family include D-lactate dehydrogenase, this enzyme catalyzes the conversion of D-lactate to pyruvate using FAD as a co-factor; mitomycin radical oxidase, this enzyme oxidizes the reduced form of mitomycins and is involved in mitomycin resistance. This family includes MurB an UDP-N-acetylenolpyruvoylglucosamine reductase enzyme EC:1.1.1.158. This enzyme is involved in the biosynthesis of peptidoglycan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ49297.1|GH31	1.36e-115	17	588	8	519
QYS96687.1|GH31	1.92e-115	17	588	8	519
UKZ75824.1|GH31	1.19e-113	17	588	8	519
UPK91582.1|GH31	8.57e-113	17	588	6	516
RDX44700.1|AA7|1.1.3.-	5.12e-16	51	272	66	272

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4UD8_A	4.29e-16	28	243	51	266	AtBBE15 [Arabidopsis thaliana],4UD8_B AtBBE15 [Arabidopsis thaliana]
6FYD_A	7.82e-16	51	224	42	204	The crystal structure of EncM T139V mutant [Streptomyces maritimus],6FYD_B The crystal structure of EncM T139V mutant [Streptomyces maritimus],6FYD_C The crystal structure of EncM T139V mutant [Streptomyces maritimus],6FYD_D The crystal structure of EncM T139V mutant [Streptomyces maritimus]
6FYF_A	1.38e-15	51	224	42	204	The crystal structure of EncM V135M mutant [Streptomyces maritimus],6FYF_B The crystal structure of EncM V135M mutant [Streptomyces maritimus],6FYF_C The crystal structure of EncM V135M mutant [Streptomyces maritimus],6FYF_D The crystal structure of EncM V135M mutant [Streptomyces maritimus]
1ZR6_A	1.61e-15	51	231	40	211	The crystal structure of an Acremonium strictum glucooligosaccharide oxidase reveals a novel flavinylation [Sarocladium strictum],2AXR_A Crystal structure of glucooligosaccharide oxidase from Acremonium strictum: a novel flavinylation of 6-S-cysteinyl, 8alpha-N1-histidyl FAD [Sarocladium strictum]
6FYB_A	1.84e-15	51	224	42	204	The crystal structure of EncM L144M mutant [Streptomyces maritimus],6FYB_B The crystal structure of EncM L144M mutant [Streptomyces maritimus],6FYB_C The crystal structure of EncM L144M mutant [Streptomyces maritimus],6FYB_D The crystal structure of EncM L144M mutant [Streptomyces maritimus],6FYC_A The crystal structure of EncM L144M mutant complex with dioxygen under 15 bars O2 pressure [Streptomyces maritimus],6FYC_B The crystal structure of EncM L144M mutant complex with dioxygen under 15 bars O2 pressure [Streptomyces maritimus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O06997|YVDP_BACSU	2.79e-19	48	241	27	211	Uncharacterized FAD-linked oxidoreductase YvdP OS=Bacillus subtilis (strain 168) OX=224308 GN=yvdP PE=1 SV=1
sp|Q93ZA3|BBE13_ARATH	1.36e-17	25	243	50	268	Berberine bridge enzyme-like 13 OS=Arabidopsis thaliana OX=3702 GN=At1g30760 PE=1 SV=1
sp|Q9SVG3|BBE21_ARATH	3.25e-17	54	251	86	287	Berberine bridge enzyme-like 21 OS=Arabidopsis thaliana OX=3702 GN=At4g20840 PE=2 SV=1
sp|Q9SVG4|RETOL_ARATH	4.73e-17	52	237	85	263	Berberine bridge enzyme-like 19 OS=Arabidopsis thaliana OX=3702 GN=At4g20830 PE=1 SV=2
sp|Q9FKU9|BBE25_ARATH	7.67e-17	25	281	52	288	Berberine bridge enzyme-like 25 OS=Arabidopsis thaliana OX=3702 GN=At5g44390 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000059	0.000001

TMHMM  Annotations     

There is no transmembrane helices in KAF5686817.1.